Loading...
Agenda 11-18-14 Page 1 of 804 Page 2 of 804 Page 3 of 804 Page 4 of 804 Page 5 of 804 Page 6 of 804 Page 7 of 804 Page 8 of 804 Page 9 of 804 Page 10 of 804 Page 11 of 804 Page 12 of 804 Page 13 of 804 Page 14 of 804 Page 15 of 804 Page 16 of 804 Page 17 of 804 Page 18 of 804 Page 19 of 804 Page 20 of 804 Page 21 of 804 Page 22 of 804 Page 23 of 804 Page 24 of 804 Page 25 of 804 Page 26 of 804 Page 27 of 804 Page 28 of 804 Page 29 of 804 Page 30 of 804 Page 31 of 804 Page 32 of 804 Page 33 of 804 Page 34 of 804 Page 35 of 804 Page 36 of 804 Page 37 of 804 Page 38 of 804 Page 39 of 804 Page 40 of 804 Page 41 of 804 Page 42 of 804 Page 43 of 804 Page 44 of 804 Page 45 of 804 Page 46 of 804 Page 47 of 804 Page 48 of 804 Page 49 of 804 Page 50 of 804 Page 51 of 804 Page 52 of 804 Page 53 of 804 File: COALA Consortium GC#331022 LONG TERM AGREEMENT BETWEEN COALA CONSORTIUM AND SIRSIDYNIX except temporarily during the process of platform migration. 2.2.3 1. PURPOSE AND SCOPE Customer shall use the Third Party Products solely in conjunction with the 1.1 Parties and Effective Date. This Long Term Agreement SirsiDynix Software and Customer shall have no broader rights with Agreement) is entered into between Sirsi Corporation dba SirsiDynix respect to the Third Party Products than it has to the SirsiDynix Software. SirsiDynixidentified in the signature block below SirsiDynix may add and/or substitute functionally equivalent products for Customer, with effect on the date of the last signature below any third party items in the event of product unavailability, end-of-life, or Effective Date. changes to software requirements. 1.2 Purpose. This Master Agreement establishes the general terms and 2.3.1 Subscriptions. For Subscriptions purchased by Customer, and conditions to which the parties have agreed with respect to the provision of subject to the terms and conditions of this Master Agreement including Products by SirsiDynix to Customer. Additional terms for the purchase of a without limitation the restrictions set forth in Sections 2.7 and 2.9 and specific Product are set forth in the Quote(s). By signing below, the parties timely payment of the applicable fees, SirsiDynix grants to Customer the acknowledge receipt of and agree to be bound by the terms and conditions right to access and use the Subscription identified in the Quote solely for of this Master Agreement and the Quote(s) for Products purchased by Internal Business Purposes and to use the Documentation in connection Customer. All pre-printed or standard terms of any Customer purchase with such access and use for the Term. SirsiDynix shall use commercially  order or other business processing document shall have no effect reasonable efforts to make the Subscription Services available 24x7, 1.3 Incorporation of QuotesQuote except for scheduled downtime events, or emergency downtime events, or of actual name, executed by the parties which is incorporated by reference Internet service provider failures or delays. SirsiDynix will use into the terms of this Master Agreement, and describes order-specific commercially reasonable efforts to perform scheduled downtime events information, such as description of Product ordered, License Metrics, fees, outside of normal business hours. Customer acknowledges that the statements of work, exhibits and milestones. At any time after execution of Subscription Services may be subject to limitations, delays, and other the Master Agreement and the initial Quote, Customer may purchase problems inherent in the use of the Internet and electronic additional Products or otherwise expand the scope of existing licenses or communications. SirsiDynix is not responsible for any delays, delivery Subscriptions granted under a Quote, upon SirsiDynix receipt and  failures, or other damage resulting from such problems2.3.2 Customer is acceptance of a new Quote specifying the foregoing. solely responsible for obtaining and maintaining at its own expense, all equipment that may be needed to access Subscriptions, including without 1.4 Incorporation of EULAs. use of any Third Party Products limitation, Internet connections. Customer understands that Subscription licensed hereunder or incorporated in the Products may be subject to, and communications may traverse an unencrypted public Internet connection Customer shall sign and comply with, any applicable EULAs. and that use of the Internet provides the opportunity for unauthorized third 1.5 Order of Precedence. To the extent any terms and conditions of this parties to illegally gain access to Customer Data. Accordingly, SirsiDynix Master Agreement conflict with the terms and conditions of a Quote, the does not guaranty the privacy, security or authenticity of any information terms and conditions of the Master Agreement shall control, except where transmitted over or stored in any system connected to the Internet. 2.3.3 the Quote expressly states the intent to supersede a specific portion of the Customer is responsible for maintaining the confidentiality of all passwords Master Agreement. To the extent any terms and conditions of this Master and for ensuring that each password is used only by the authorized user. Agreement conflict with the terms and conditions of an EULA, the terms Customer is responsible for all activities that occur under Customer's and conditions of the EULA shall control. account. Customer agrees to immediately notify SirsiDynix of any 2. PRODUCTS USE RIGHTS; TITLE unauthorized use of Customer's account or any other breach of security known to Customer. SirsiDynix shall have no liability for any loss or 2.1 Generally. ter damage arising from Customer's failure to comply with these requirements. Agreement may include from time-to-time Software, Subscriptions, 2.3.4 Customer shall be solely responsible for the accuracy, quality, Services, and/or Hardware. The following provisions under this Section 2 integrity and legality of Customer Data and of the means by which it apply if relevant to the type of Product purchased pursuant to a Quote. acquired Customer Data. Customer acknowledges and agrees that 2.2.1 Software License. Subject to the terms and conditions of this Master SirsiDynix does not monitor or police the content of communications or Agreement including without limitation the restrictions set forth in Section data of Customer or its users transmitted through the Subscriptions, and 2.7 and Section 2.9 and timely payment of the applicable fees, SirsiDynix that SirsiDynix shall not be responsible for the content of any such hereby grants to Customer a limited, non-exclusive, non-transferable and communications or transmissions. Customer shall use the Subscriptions perpetual (subject to SirsiDynix termination rights pursuant to this Master exclusively for authorized and legal purposes, consistent with all applicable Agreement) license to (i) install, run and use the Software identified in the laws and regulations. Customer agrees not to post or upload any content Quote in the Operating Environment solely for Internal Business Purposes, or data which (a) is libelous, defamatory, obscene, pornographic, abusive, and (ii) use the Documentation in connection with such use of the harassing or threatening; (b) contains viruses or other contaminating or Software. Customer may not make copies of the Software except a destructive features; (c) violates the rights of others, such as data which reasonable number of machine-readable copies solely for internal backup infringes on any intellectual property rights or violates any right of privacy or archival purposes. All Intellectual Property rights notices must be or publicity; (d) constitutes sensitive personal information such as social reproduced and included on such copies. Customer shall maintain security numbers, credit card information, or drivers license numbers; or accurate and up-to-date records of the number and location of all copies of (e) otherwise violates any applicable law. Customer further agrees not to the Software and inform SirsiDynix in writing of such upon request. 2.2.2 interfere or disrupt networks connected to the Subscriptions, not to Unless otherwise set forth in a Quote, the Software shall not be interfere with another use and enjoyment of similar services simultaneously loaded and operated on more than one hardware platform, and to comply with all regulations, policies and procedures of networks Customer Initial and Date: dl.initialhere.1 Confidential Page 1 of 8 Page 54 of 804 File: COALA Consortium GC#331022 connected to the Subscriptions. SirsiDynix may remove any violating service requests are deemed excessive as a result of insufficient training, content posted or transmitted on or through the Subscriptions, without 2.5.9 In the event Customer does not renew notice to Customer. SirsiDynix may suspend or terminMaintenance and subsequently desires to reinstate Maintenance, a access to the Subscriptions upon notice in the event that SirsiDynix reinstatement fee shall be assessed equal to 120% of the aggregate reasonably determines that such user has violated these terms and Maintenance fee that would have been payable during the period of lapse. conditions. 2.3.5 The provision of third party Subscriptions is subject to 2.5.10 For Software licenses and Subscription Software, Customer is availability from third party providers and SirsiDynix shall have no liability solely responsible for the installation of Updates and agrees to (i) meet the should such Subscription become unavailable for any reason or is no Update standard set forth in the SirsiDynix Support Policies referenced in longer available under reasonable commercial terms. 2.3.6 In the event the definition of Maintenance and (ii) maintain the Operating Environment. that Customer is locally hosting Subscription Software, SirsiDynix hereby With respect to Subscriptions, SirsiDynix is responsible for the grants to Customer, subject to the terms and conditions of this Master implementation of Updates and shall no longer provide access to any Agreement including without limitation the restrictions set forth in Section previous release upon the date SirsiDynix migrates to a new Update for  2.7 and Section 2.9 and timely payment of the applicable fees, a limited, production use non-exclusive, non-transferable grant of use to locally install and use the 2.6.1 Hardware and Hardware Maintenance. Title to the Hardware Subscription internal business purposes. identified in the Quote, if any, The grant of use for Subscription Software is not a license and remains in placement of the Hardware with a common carrier or licensed trucker, effect only while Customer is timely paying its Subscription fees to which shall constitute delivery to Customer. Thereafter Customer will be SirsiDynix. If Customer fails to timely pay Subscription fees, Customer responsible for risks of loss or damage, except for loss or damage caused must immediately discontinue use of and certify to SirsiDynix the removal by SirsiDynix in the process of installation. 2.6.2 SirsiDynix does not of Subscription Software. provide support for Hardware unless Customer purchases any available 2.4.1 Services. Services are described in the Quote. SirsiDynix shall be maintenance associated with such Hardware. Such Hardware responsible for securing, managing, scheduling, coordinating and maintenance may be provided through a third party and is subject to that supervising SirsiDynix personnel, including its subcontractors, in ons and warranties, if any. performing any Services. Any change to the scope of Services must be in 2.7 License Metrics. Customer may not use the Products in excess writing signed by both parties. Once executed by both parties, a change of the License Metrics specified in the Quote. Additional License Metrics shall become a part of the Quote. 2.4.2 Customer acknowledges and and associated Maintenance must be purchased at the pricing in effect at agrees that SirsiDynix performance is dependent upon the timely and the time the additional License Metrics are added in the event actual usage effective satisfac exceeds the licensed quantity, prorated for the remainder of the then- decisions and approvals of Customer in connection with the Services. current Term. The additional License Metrics purchased shall terminate on SirsiDynix shall be entitled to rely on all decisions and approvals of the same date as the pre-existing Products. Prices are based on License Customer. a format Metrics purchased and not actual usage. The number of License Metrics reasonably approved by SirsiDynix or additional charges will apply. provided in the initial Quote is a minimum amount that Customer has Customer shall be responsible for providing secured access to committed to for the Term and there shall be no fee adjustments or refunds systems to SirsiDynix. SirsiDynix alone shall decide whether such access for any decreases in usage. is sufficient for the performance of Services. 2.8 Reservation of Rights. All rights not expressly granted in the 2.5. Software Maintenance. 2.5.1 Master Agreement are reserved by SirsiDynix and its third party providers. of applicable fees, SirsiDynix will provide during the Term Maintenance Customer acknowledges that: (i) all Software is licensed and not sold and services for the Software in accordance with the maintenance plan all Subscriptions and Content are subscribed to and not sold; (ii) Customer indicated in the Quote, provided however that with respect to Third Party acquires only the right to use the Protected Materials. SirsiDynix and its Products third party providers retain sole and exclusive ownership and all rights, commercially reasonable efforts to obtain Maintenance from the third party title, and interest in, including Intellectual Property embodied or associated owner of such Softwaresession must be with, the Protected Materials and all copies and derivative works thereof supported under the same maintenance plan. 2.5.2 Updates are provided (whether developed by SirsiDynix, Customer or a third party); and (iii) the if and when available, and SirsiDynix is under no obligation to develop any Protected Materials, including the source and object codes, logic and future programs or functionality. 2.5.3 SirsiDynix is under no obligation to structure, constitute valuable trade secrets of SirsiDynix and its third party provide Maintenance with respect to: (i) a Product that has been altered or providers. Customer agrees to secure and protect the Products consistent modified by anyone other than SirsiDynix or its licensors; (ii) a release for which Maintenance has been discontinued; (iii) a Product used other than the Products, as set forth in this Master Agreement. in accordance with the Documentation or other than on the Operating 2.9 Restrictions. Unless specifically permitted or licensed by Environment; (iv) discrepancies that do not significantly impair or affect the SirsiDynix, Customer shall not itself, or through any affiliate, employee, operation of the Product; or (v) any systems or programs not supplied by consultant, contractor, agent or other third party: (i) sell, resell, distribute,  SirsiDynix. 2.5.4For the avoidance of doubt, Updates provided under host, lease, rent, license or sublicense, in whole or in part, the Protected Maintenance services are subsequent minor or maintenance releases to Materials; (ii) decipher, decompile, disassemble, reverse assemble, the standard Products, excluding custom development or customizations modify, translate, reverse engineer or otherwise attempt to derive source whether such customizations are performed by SirsiDynix or by Customer code, algorithms, tags, specifications, architecture, structure or other or a third party. SirsiDynix reserves the right to charge Client for any elements of the Protected Materials, including the license keys, in whole or reintegration work required to make customizations compatible with future in part, for competitive purposes or otherwise; (iii) allow access to, provide, releases. 2.5.5 If ordered, Maintenance must be ordered for all Software divulge or make available the Protected Materials to any user other than and all associated License Metrics licensed by Customer. Customer may yees and independent contractors who have a need to not purchase or renew Maintenance for a subset of its licenses only. 2.5.6 such access and who shall be bound by a nondisclosure agreement with If an Error was corrected or is not present in a more current release of the provisions that are at least as restrictive as the terms of this Master Product, SirsiDynix shall have no obligation to correct such Errors in prior Agreement (except the Customer may grant access to public access releases of the Software. 2.5.7 Fees for Maintenance Services do not catalogs to library users, other libraries, and third party entities); (iv) write include implementation, training and other Professional Services. 2.5.8 It is or develop any derivative works based upon the Protected Materials; (v) modify, adapt, translate or otherwise make any changes to the Protected training services sufficient to enable Customer to effectively use the Materials or any part thereof; (vi) use the Protected Materials to provide Software. Failure to do so could result in additional Maintenance fees if Customer Initial and Date: dl.initialhere.1 Confidential Page 2 of 8 Page 55 of 804 File: COALA Consortium GC#331022 processing services to third parties, or otherwise use the same on a rates published by the U.S. General Services Administration. Airfare for s prior SirsiDynix personnel shall be at reasonable, coach rates. written consent, performance or capacity statistics or the results of any 4. CONFIDENTIALITY benchmark test performed on the Protected Materials; or (viii) otherwise 4.1 Non-Disclosure use or copy the Protected Materials except as expressly permitted herein. Confidential Information from unauthorized dissemination and use the 2.10 Customer Data. SirsiDynix disclaims ownership of any and all same degree of care that each such party uses to protect its own Customer Data, all bibliographic, authority, item, fine, patron, and other confidential information, but in no event less than a reasonable amount of care. Neither party will use Confidential Information of the other party for supplied to SirsiDynix by Customer. purposes other than those necessary to directly further the purposes of the ownership of Customer Data, at the end of the Term SirsiDynix shall only Master Agreement. Neither party will disclose to third parties Confidential be obligated to provide to Customer extractable Customer Data at no Information without prior written consent of the other party. additional charge in a supported MARC and/or ASCII delimited format. 4.2 Exceptions. Information shall not be considered Confidential SirsiDynix shall have the right to aggregate and retain non-personally Information to the extent, but only to the extent, that the receiving party can identifiable data. establish that such information (i) is or becomes generally known or 2.11 License Grant by Customer. Customer grants to SirsiDynix a available to the public through no fault of the receiving party; (ii) was in the non-exclusive, royalty-free license, to use equipment, software, Customer receiving party's possession before receipt from the disclosing party; (iii) is Data or other material of Customer solely for the purpose of performing lawfully obtained from a third party who has the right to make such obligations under the Master Agreement. disclosure on a non-confidential basis; (iv) has been independently 2.12 Enforcement. Customer shall (i) ensure that all users of the developed by one party without reference to any Confidential Information Products comply with the terms and conditions of the Master Agreement, of the other; (v) is information aggregated by SirsiDynix that no longer (ii) promptly notify SirsiDynix of any actual or suspected violation thereof contains any personally identifiable information; or (vi) is required to be and (iii) cooperate with SirsiDynix with respect to investigation and disclosed by law provided the receiving party has promptly notified the enforcement of the Master Agreement. disclosing party of such requirement and allowed the disclosing party a reasonable time to oppose such requirement. The parties acknowledge 3. FINANCIAL TERMS that Customer may be subject to freedom of information legislation and 3.1.1 Fees and Payment Terms The Customer is responsible for the  further acknowledges that such legislation may take precedence over the payment of the fees and other charges as specified in the Quote. Each confidentiality provisions of this section as they apply to Customer. No part member of the cooperative shall be responsible for a portion of each of this Agreement shall be interpreted as prohibiting the release of any invoice as follows (fees are exclusive of, and Customer is responsible for, data when such a release is required by a State or Federal law then in- shipping costs): force. Member Name Percentage of Responsibility 5. PRIVACY Customer represents and warrants that before providing personally Boynton Beach Public Library 29% identifiable information to SirsiDynix or its agents, it will comply with any Delray Beach Public Library 29% laws applicable to the disclosure of personally identifiable information, including providing notices to or obtaining permission from third parties to Lake Park Public Library 14% allow sharing of their personally identifiable information with SirsiDynix under the Master Agreement. Customer will indemnify SirsiDynix for any Palm Springs Public Library 14% breach of this representation and warranty. No personally identifiable information will be disseminated by SirsiDynix to any third parties, except North Palm Beach Public Library 14% as consented to by Customer or required by law. Subject to the provisions of the Quote, SirsiDynix may annually increase 6. INDEMNIFICATION the fees of Subscription, Subscription Software and/or Maintenance upon 30 days written notice in advance. Invoices become past due 30 days after 6.1.1 By SirsiDynix. SirsiDynix will defend or settle, at its option and the invoice date. Interest accrues on past due balances at the higher of expense, any action, suit or proceeding brought against Customer that the 1½% per month or the highest rate allowed by law. If Customer fails to SirsiDynix Software (excluding Content and Third Party Products) infringe make payments of any amount due under the Master Agreement, SirsiDynix will be entitled to suspend its performance upon ten (10) days Claim SirsiDynix will indemnify Customer against all damages and written notice to Customer. 3.1.2 Unless expressly provided otherwise, costs finally awarded which are attributable exclusively to such Claim, amounts paid or payable for Software, Subscriptions, Subscription provided that Customer: (i) promptly gives written notice of the claim to Software and Hardware are not contingent upon the performance of any SirsiDynix; (ii) gives SirsiDynix sole control of the defense and settlement Services. s expense, with all available information and assistance relating to the Claim and cooperates 3.2 Taxes. Customer agrees to pay any sales tax arising out of the with SirsiDynix and its counsel; (iv) does not compromise or settle such Master s net income. If Claim; and (v) is not in material breach of any agreement with SirsiDynix. Customer is tax-exempt, Customer agrees to send SirsiDynix a copy of its 6.1.2 SirsiDynix has no obligation to the extent any Claim results from: (i) tax-exempt certificate upon execution of the Master Agreement. Customer Customer having modified the SirsiDynix Software or used a release other agrees to indemnify SirsiDynix from any liability or expense incurred by than the most current unaltered release of the SirsiDynix Software, if such such sales an infringement would have been avoided by the use of such current tax due. unaltered release, (ii) Third Party Products and/or Content, or (iii) the 3.3 No Contingencies. Customer agrees that its purchases hereunder combination, operation or use of the SirsiDynix Software with software or are neither contingent on the delivery of any future functionality or features data not provided by SirsiDynix. 6.1.3 If it is adjudicated that the use of the nor dependent on any oral or written comments made by SirsiDynix SirsiDynix Software in accordance with the Master Agreement infringes regarding future functionality or features. any USA patent, registered copyright, or registered trademark, SirsiDynix 3.4 Travel Expenses. Unless otherwise noted within the Quote, travel shall, at its option: (i) procure for Customer the right to continue using the expenses will be billed separately at actual cost. Costs associated with infringing SirsiDynix Software; (ii) replace or modify the same so it travel by SirsiDynix personnel shall not exceed the then-present per diem becomes non-infringing; or (iii) Customer will be entitled to an equitable Customer Initial and Date: dl.initialhere.1 Confidential Page 3 of 8 Page 56 of 804 File: COALA Consortium GC#331022 adjustment in the fees paid for the affected SirsiDynix Software. THIS ERROR-FREE AND (iv) ANY AND ALL IMPLIED WARRANTIES ARISING S ENTIRE OBLIGATION TO FROM STATUTE, COURSE OF DEALING, COURSE OF CLAIM OF PERFORMANCE OR USAGE OF TRADE. NO ADVICE, STATEMENT OR INFRINGEMENT. INFORMATION GIVEN BY SIRSIDYNIX, ITS AFFILIATES, CONTRACTORS OR EMPLOYEES SHALL CREATE OR CHANGE ANY 7. WARRANTIES; REMEDIES; DISCLAIMERS WARRANTY PROVIDED HEREIN. CUSTOMER ACKNOWLEDGES 7.1 SirsiDynix Software. SirsiDynix warrants that, for a period of 90 days THAT USE OF OR CONNECTION TO THE INTERNET PROVIDES THE from the Go Live Date, the SirsiDynix Software, as updated by SirsiDynix OPPORTUNITY FOR UNAUTHORIZED THIRD PARTIES TO and used in accordance with the Documentation and in the Operating CIRCUMVENT SECURITY PRECAUTIONS AND ILLEGALLY GAIN Environment, will operate in all material respects in conformity with the ACCESS TO THE SERVICES AND CUSTOMER DATA AND THAT NO Documentation. FORM OF ENCRYPTION IS FOOL PROOF. ACCORDINGLY, If SirsiDynix Software does not perform as warranted, SirsiDynix shall use SIRSIDYNIX CANNOT AND DOES NOT GUARANTEE THE PRIVACY, commercially reasonable efforts to correct Errors. As Customer's exclusive SECURITY OR AUTHENTICITY OF ANY INFORMATION SO remedy for any claim under this warranty, Customer shall promptly notify TRANSMITTED OVER OR STORED IN ANY SYSTEM CONNECTED TO SirsiDynix in writing of its claim. Provided that such claim is reasonably THE INTERNET. 8. EXCLUSION AND LIMITATION OF LIABILITY within ninety (90) days of its receipt of Customer's written notice; (i) correct 8.1 S such Error; (ii) provide Customer with a plan reasonably acceptable to TOTAL LIABILITY (INCLUDING ATTORNEYS FEES AWARDED UNDER Customer for correcting the Error; or (iii) if neither (i) nor (ii) can be THE MASTER AGREEMENT) TO CUSTOMER FOR ANY CLAIM BY accomplished with reasonable commercial efforts from SirsiDynix, then CUSTOMER OR ANY THIRD PARTIES UNDER THE MASTER SirsiDynix or Customer may terminate the affected SirsiDynix Software AGREEMENT, EXCLUDING LIABILITY PURSUANT TO SECTION 6 license and Customer will be entitled to an equitable adjustment in the fees (Indemnification), WILL BE LIMITED TO THE FEES PAID BY CUSTOMER paid for the affected SirsiDynix Software DURING THE PREVIOUS 12 MONTHS FOR THE PRODUCT WHICH IS THE SUBJECT MATTER OF THE CLAIM. Customer's exclusive remedy for cure of the warranty set forth herein. 8.2 IN NO EVENT WILL SIRSIDYNIX BE LIABLE TO CUSTOMER FOR 7.2 SirsiDynix Subscriptions. SirsiDynix warrants that Subscriptions, as ANY INDIRECT, SPECIAL, INCIDENTAL, EXEMPLARY PUNITIVE, used in accordance with the Documentation, will operate in all material TREBLE OR CONSEQUENTIAL DAMAGES (INCLUDING, WITHOUT respects in conformity with the Documentation. LIMITATION, LOSS OF BUSINESS, REVENUE, PROFITS, STAFF TIME, 7.3 Exclusions. SirsiDynix is not responsible for any claimed breach of GOODWILL, USE, DATA, OR OTHER ECONOMIC ADVANTAGE), any warranty caused by: (i) modifications made to the SirsiDynix Software WHETHER BASED ON BREACH OF CONTRACT, BREACH OF by anyone other than SirsiDynix; (ii) the combination, operation or use of WARRANTY, TORT (INCLUDING NEGLIGENCE), PRODUCT LIABILITY the SirsiDynix Software with any items that are not part of the Operating OR OTHERWISE, WHETHER OR NOT SIRSIDYNIX HAS PREVIOUSLY Environmentreleases BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. of the SirsiDynix Software 8.3 NO CLAIM ARISING OUT OF THE MASTER AGREEMENT, REGARDLESS OF FORM, MAY BE BROUGHT BY CUSTOMER MORE deviating from the operating procedures described in the Documentation. THAN TWO YEARS AFTER THE CAUSE OF ACTION ARISES. 7.4 Third Party Products. SirsiDynix warrants that it is an authorized 9. TERM AND TERMINATION distributor of the Third Party Product and that with the execution of this 9.1 Term of Master Agreement. Subject to Section 10.12 below, the Master Agreement and the applicable EULA, Customer will have the right to use such Product in accordance with the terms and conditions of the term of this Master Agreement shall commence on the Effective Date and terms of this Master Agreement and the applicable EULA. SIRSIDYNIX shall continue in full force and effect until the expiration or termination of all MAKES NO OTHER WARRANTY WITH RESPECT TO ANY THIRD Quotes, unless otherwise terminated earlier as provided hereunder. PARTY PRODUCTS. 9.2 Product and Services Term. The respective initial term of TO SUCH THIRD PARTY PRODUCTS SHALL BE PURSUANT TO THE Software Maintenance, Hardware Maintenance, Subscriptions, and Subscription Software as applicable, is specified in the Quote EXTENT PERMITTED BY THE ORIGINAL LICENSOR. THIRD PARTY Term PRODUCTS ARE MADE AVAILABLE BY SIRSIDYNIX ON AN "AS IS, AS the Initial Term unless either party gives written notice 60 days prior to the AVAILABLE" BASIS. end of any previous Term of its intention to terminate the Subscription or 7.5 Hardware. SirsiDynix warrants that it is an authorized distributor of the Maintenance service. The Initial Term and renewal terms are referred to as Hardware. Term warranty. SIRSIDYNIX MAKES NO WARRANTIES OF ANY KIND WITH 9.3.1 Termination. Either party may terminate the Master Agreement RESPECT TO HARDWARE OR HARDWARE MAINTENANCE. immediately upon written notice if the other party commits a non- HARDWARE remediable material breach of the Master Agreement, or if the other party OR HARDWARE MAINTENANCE SHALL BE PURSUANT TO THE fails to cure any remediable material breach or provide a written plan of cure acceptable to the non-breaching party within 30 days of being notified 7.6 Disclaimers. THE WARRANTIES SET FORTH IN THIS MASTER in writing of such breach. Where the non-breaching party has a right to AGREEMENT ARE IN LIEU OF, AND SIRSIDYNIX, ITS LICENSORS terminate the Master Agreement, the non-breaching party may at its AND SUPPLIERS EXPRESSLY DISCLAIM TO THE MAXIMUM EXTENT discretion terminate the Master Agreement or the applicable Quote. PERMITTED BY LAW, ALL OTHER WARRANTIES, EXPRESS OR Quotes that are not terminated shall continue in full force and effect under the terms of this Master Agreement 9.3.2 Following termination of the IMPLIED, ORAL OR WRITTEN, INCLUDING, WITHOUT LIMITATION, (i) ANY WARRANTY THAT ANY PRODUCT IS ERROR-FREE OR WILL Master Agreement, Customer agrees to certify that it has returned or OPERATE WITHOUT INTERRUPTION OR THAT ALL ERRORS WILL BE destroyed all copies of the applicable Product and Confidential Information and acknowledges that its rights to use the same are relinquished. 9.3.3 CORRECTED; (ii) ANY AND ALL IMPLIED WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE, AND Fees. Customer acknowledges that, based on NON-INFRINGEMENT, (iii) ANY WARRANTY THAT CONTENT OR purchase Products for the Term, SirsiDynix has provided Customer with THIRD PARTY PRODUCTS WILL BE ACCURATE, RELIABLE AND Products and Services at rates that represent a substantial discount from Customer Initial and Date: dl.initialhere.1 Confidential Page 4 of 8 Page 57 of 804 File: COALA Consortium GC#331022 the rates that SirsiDynix would otherwise charge, along with certain other hereunder on behalf of the US Government with U.S. Government federal free or substantially discounted products or services. Customer therefore funding, notice is hereby given that the Software is commercial computer agrees that it is reasonable for Customer to pay a fee to SirsiDynix in the software and documentation developed exclusively at private expense and event of early termination for any reason, which becomes effective upon is any date prior to the end of the last year of the Initial Term or prior to the Software delivered subject to the FAR 52.227-19. All use, duplication and end of any renewal term. Such fee shall be equal to 50% of the remaining disclosure of the Software by or on behalf of the U.S. Government shall be value of the then-current Term of the Products or Services, as applicable. subject to this Master Agreement and the restrictions contained in Customer agrees that damages suffered by SirsiDynix in the event of such subsection (c) of FAR 52.227-19, Commercial Computer Software - early termination are difficult or impossible to determine and that the above amount is intended to be a reasonable approximation of such damages 10.6 Export. Customer shall comply fully with all relevant export laws and not a penalty. Customer agrees that it will pay such amounts within and regulations of the United States to ensure that the Software is not thirty (30) days of any such early termination. Customer shall notify exported, directly or indirectly, in violation of United States law. SirsiDynix in writing of its intent to terminate not less than sixty (60) days 10.7 Non-solicitation. During the term of this Master Agreement and prior to the date of termination and Customer shall not be eligible for any for a period of one year following its termination, neither party will solicit for pro-rata credit or refund for unused partial year fees paid. 9.3.4 Non- Appropriation of Funds. If for any given fiscal year the library loses all written permission, any individual employed by the other party, provided funding, the Master Agreement will be suspended at no penalty to however that the hiring of individuals responding to general public marketing and recruiting advertisements and events shall not be a violation to the renewal period. Such notice will not relieve Customer of payments of this provision; only active, targeted solicitation is prohibited. then owing. Customer shall not purchase similar materials, supplies, 10.8 Compliance. During the term of this Master Agreement and for a services, or items of equipment during the anticipated life of the terminated period of one year following its termination, SirsiDynix shall have the right Master Agreement without notification to SirsiDynix and reinstatement of to verify the terminated Master Agreement. Master Agreement. If such verification process reveals any noncompliance 9.4. Suspension. SirsiDynix will be entitled to suspend any or all by Customer, Customer shall reimburse SirsiDynix for the reasonable performance upon 10 days written notice to Customer in the event costs and expenses of such verification process incurred by SirsiDynix Customer is in breach of the Master Agreement. Further, SirsiDynix may , and Customer suspend shall promptly cure any such noncompliance; provided, however, that the s security risk created by Customer that may interfere with the proper termination rights continued provision of services or the operation of Sir Products and interest fees related to usage in excess of the License systems. SirsiDynix may impose an additional charge to reinstate service Metrics. following such suspension. 10.9 Notices. Any notice required or permitted to be sent under the 10. GENERAL PROVISIONS Master Agreement shall be delivered by hand, by overnight courier, by 10.1 Force Majeure. The parties will exercise every reasonable effort to email to SirsiDynix at legal@sirsidynix.com, or by email to Customer at meet their respective obligations hereunder but shall not be liable for any current Customer email address routinely used by SirsiDynix, or by delays resulting from force majeure or other causes beyond their registered mail, return receipt requested, to the address of the parties set reasonable control, including but not limited to power outages or failure of forth in the Master Agreement or to such other address of the parties third party service providers. This provision does not relieve Customer of designated in writing in accordance with this subsection. its obligation to make payments then owing. 10.10 Relationship. The Master Agreement is not intended to create a 10.2 AssignmentSirsiDynix may assign the Master Agreement and all  partnership, franchise, joint venture, agency, or a fiduciary or employment to its relationship. Neither party may bind the other party or act in a manner parent company or other affiliated company, to a successor by operation of which expresses or implies a relationship other than that of independent law, or by reason of the sale or transfer of all or substantially all of its stock contractor. or assets to another entity. Neither party may otherwise assign or transfer 10.11 Invalidity If any provision of the Master Agreement shall be held  the Master Agreement without the prior written consent of the other party, to be invalid, illegal or unenforceable, the validity, legality and which shall not be unreasonably withheld. Notwithstanding the above, enforceability of the remaining provisions shall not in any way be affected SirsiDynix may fulfill its obligations hereunder through its affiliated or impaired. companies. 10.12 Survival. The following provisions will survive any termination or 10.3 CooperationCustomer agrees to provide cooperation, which  expiration of the Master Agreement: sections 1, 2.7, 2.8, 2.10, 2.12, 3, 4, 5, means assistance, information, equipment, data, a suitable work 6, 7, 8, 9, and 10. environment, timely access, and resources reasonably necessary to 10.13 No Waiver. Any waiver of the provisions of the Master Agreement enable SirsiDynix to perform any and all installation, implementation, and services required to fulfill its obligations hereunder including but not limited Master Agreement must be in writing to be effective. Any such waiver shall constitute a waiver only with to ensuring SirsiDynix has remote access. Failure to grant such respect to the specific matter described in such writing and shall in no way cooperation shall allow SirsiDynix to deem the Product purchased by Customer to be fully accepted and delivered. In the event any delay in impair the rights of the party granting such waiver in any other respect or at any other time. The waiver by either of the parties hereto of a breach or of implementing Products is caused by Customer resulting in SirsiDynix a default under any of the provisions of the Master Agreement shall not be incurring additional expenses, the Customer shall pay to SirsiDynix the amount of such additional expenses. construed as a waiver of any other breach or default of a similar nature, or as a waiver of any of such provisions, rights or privileges hereunder. The 10.4 Delegation. SirsiDynix may subcontract or delegate any work rights and remedies herein provided are cumulative and none is exclusive of any other, or of any rights or remedies that any party may otherwise consent, provided however that SirsiDynix shall remain responsible for the have at law or in equity. Failure, neglect, or delay by a party to enforce the performance of any such subcontractors. provisions of the Master Agreement or its rights or remedies at any time, 10.5 Notice of U.S. Government Restricted Rights. If the Customer shall not be construed and shall not be deemed to be a waiver of such hereunder is the U.S. Government, or if the Software is acquired Master Agreement and shall not in any way affect Customer Initial and Date: dl.initialhere.1 Confidential Page 5 of 8 Page 58 of 804 File: COALA Consortium GC#331022 the validity of the whole or any part of the Master Agreement or prejudice shall be litigated in the state or federal courts located in Palm Beach County Florida to whose exclusive jurisdiction the parties hereby consent. 10.14 Entire Agreement. The Master Agreement c10.17 Application of Laws. The parties agree that this contract is not a entire agreement relating to its subject matter. It cancels and supersedes contract for the sale of goods; therefore, the Master Agreement shall not all prior or contemporaneous oral or written communications, requests for be governed by any codification of Article 2 or 2A of the Uniform proposals, proposals, conditions, representations, and warranties, or other Commercial Code, or any codification of the Uniform Computer Information communication between the parties relating to its subject matter as well as any prior contractual agreements between the parties. Notwithstanding the Convention on Contracts for the International Sale of Goods. precedence of this Master Agreement, any existing Customer License 10.18 Counterparts. The Master Agreement and each Schedule may be Metrics shall continue unless new License Metrics are identified in a executed in one or more counterparts, each of which shall constitute an Quote. No modification to the Master Agreement will be binding unless in enforceable original of the Master Agreement, and that facsimile, electronic writing and signed by an authorized representative of each party. and/or .pdf scanned copies of signatures shall be as effective and binding 10.15 Third Party Beneficiaries. All rights and benefits afforded to as original signatures. SirsiDynix under the Master Agreement shall apply equally to the owner of 10.19 Headings and Drafting. The headings in the Master Agreement the Third Party Products with respect to the Third Party Products, and such shall not be used to construe or interpret the Master Agreement. The third party is an intended third party beneficiary of the Master Agreement, Master Agreement shall not be construed in favor of or against a party with respect to the Third Party Products. based on the originator of the document. 10.16 Governing Law and Venue. The Master Agreement shall be 10.20 Attorneys Fees. In the event a party seeks and obtains a remedy governed by and construed in accordance with the laws of the State of in the courts for its rights under this Master Agreement, the prevailing party Florida without giving effect to its principles of conflict of laws. Any dispute in such litigation shall be entitled to its reasonable ************************************************************ END OF MASTER AGREEMENT COALA Consortium Sirsi Corporation Boynton Beach City Library SirsiDynix Technology Centre 208 S. Seacrest Blvd. 3300 N. Ashton Blvd. Suite 500 Boynton Beach, Florida 33435 Lehi, UT 84043 Sign: dl.signhere.1 Sign: dl.signhere.2 Print Name: dl.fullname.1 Print Name: dl.fullname.2 Title: dl.title.1 Title: dl.title.2 Date: dl.datesign.1 Date: dl.datesign.2 COALA Consortium COALA Consortium Lake Park Public Library Palm Springs Public Library 529 Park Ave 217 Cypress Way W Lake Park, Florida 33403 Lake Worth, Florida 33461 Sign: dl.signhere.1 Sign: dl.signhere.2 Print Name: dl.fullname.1 Print Name: dl.fullname.2 Title: dl.title.1 Title: dl.title.2 Date: dl.datesign.1 Date: dl.datesign.2 Customer Initial and Date: dl.initialhere.1 Confidential Page 6 of 8 Page 59 of 804 File: COALA Consortium GC#331022 SIGNATURES CONTINUED ON NEXT PAGE COALA Consortium COALA Consortium Delray Beach Public Library North Palm Beach Public Library 100 W Atlantic Ave 303 Anchorage Dr Delray Beach, Florida 33444 North Palm Beach, Florida 33408 Sign: dl.signhere.1 Sign: dl.signhere.2 Print Name: dl.fullname.1 Print Name: dl.fullname.2 Title: dl.title.1 Title: dl.title.2 Date: dl.datesign.1 Date: dl.datesign.2 Customer Initial and Date: dl.initialhere.1 Confidential Page 7 of 8 Page 60 of 804 File: COALA Consortium GC#331022 Exhibit A - DEFINITIONSparty products by any means into Software, Subscriptions or Subscription Software without additional SirsiDynix license. means the checkout of a Library Item to a patron, the means limits on Product usage as set forth in the checkout of a Library Item for the purpose of tracking in-library usage, the renewal of a Library Item, or an action functionally identical to any of the Quote such as Titles, Circulation, Users, students, seats, and reports. preceding acts. aintenance means the technical support and, with respect to Confidential Information means information of SirsiDynix and/or its Software, the provision of licensors includes but is not limited to the terms and conditions (but not the s existence) of the Master Agreement, all trade secrets, software, source support policies in effect at the time the Services are provided, which may code, object code, specifications, as well as results of testing and be modified from time-to-time by SirsiDynix in its sole discretionA current benchmarking of the Software or other services, product roadmap, data and other information of SirsiDynix and its licensors relating to or Policies125773) at http://support.sirsidynix.com. embodied in the Software or Documentation, including but not limited to means SirsiDynix-recommended hardware, information designated as confidential in writing or information which ought operating system, middleware, database products and other software on to be in good faith considered confidential and proprietary to the disclosing which the Software will operate. party. s placement of a copyright notice on any portion of any means data conversion, implementation, Software will not be construed to mean that such portion has been published and will not derogate from any claim that such portion contains , training, project management and other consulting services. proprietary and confidential information of SirsiDynix. Confidential means Software, Subscriptions, Subscription Software, Information does not include that the Customer uses SirsiDynix Products. Services and Hardware. means any information, data, text, software, music, sound, means Software and work product provided by photographs, graphics, video messages or other material which Customer SirsiDynix under Services, Subscriptions, Subscription Software and receives through a Subscription. and Confidential means any electronic data, information or material Information. provided or submitted by Customer Quoteis defined in Section 1.3. users) to SirsiDynix through a Subscription or Services, or which Customer enters into the Subscription means those services provided or arranged by SirsiDynix or Services or has entered on its behalf, or which SirsiDynix is otherwise including but not limited to specific SirsiDynix Products such as (i) given access to under the Master Agreement. Customer Data does not Professional Services; and (ii) that part of Maintenance that is technical include non-personally identifiable information aggregated by SirsiDynix. support, excluding the provision of Updates. means the user instructions, release notes, manuals SirsiDynix Softwaremeans each SirsiDynix-developed and/or  and on-line help files made available by SirsiDynix regarding the use of the SirsiDynix-owned software product in machine-readable object code (not applicable Product. source code), the Documentation for such product, and any Updates thereto. is defined in section 1.1. means the SirsiDynix Software and Third Party Software. Errormeans a material failure of a Product to conform to its functional  specifications described in the Documentation. means the provision of access by SirsiDynix or its hosting providers to Software and/or Content from a server farm that is EULA means the end user license agreement that accompanies the comprised of application, data and remote access servers, including Third Party Product, which governs the use of or access by Customer to associated offline components including but not limited to cloud services the applicable Third Party Product. and web access to Content. Go Live DateProducts are substantially means Subscriptions hosted by Customer. ready for operational use for normal daily business. Customer does not have a license in Subscription Software. means the physical hardware and equipment manufactured Term by third party providers and sold to Customers by SirsiDynix. means the number of unique records for an electronic, virtual, means any and all intellectual property rights, recognized in any country or jurisdiction in the world, now or hereafter and/or physical item which may be used by a library patron, such as a bibliographic, MARC, visual material, serial or Dublin Core record, created existing, and whether or not perfected, filed or recorded, including without on the Software or Subscription. Multiple items, representing either limitation inventions, technology, patents rights (including patent applications and disclosures), copyrights, trade secrets, trademarks, identical items or volumes in a set, may be included in a single Title. service marks, trade dress, methodologies, procedures, processes, know- Third Party Products means software or content including how, tools, utilities, techniques, various concepts, ideas, methods, models, documentation and updates if any, owned by an entity other than templates, software, source code, algorithms, the generalized features of SirsiDynix and provided by SirsiDynix in connection with Products. the structure, sequence and organization of software, user interfaces and means the error corrections, releases, updates, modifications screen designs, general purpose consulting and software tools, utilities or enhancements subsequently developed that SirsiDynix makes generally and routines, and logic, coherence and methods of operation of systems, available to its customers as part of Maintenance on a when and if training methodology and materials, which SirsiDynix has created, available basis. Updates exclude new products, modules, platform or acquired or otherwise has rights in, and may, in connection with the functionality for which SirsiDynix charges a separate fee. performance of obligations hereunder, create, employ, provide, modify, create, acquire or otherwise obtain rights in. user names and passwords by Customer to use the Products. Each such User shall be one person, and user names and passwords cannot be not include (1) sharing Confidential Information or Intellectual Property with shared or used by more than one person. third parties without SirsiDynix written consent or (2) integration of third Customer Initial and Date: dl.initialhere.1 Confidential Page 8 of 8 Page 61 of 804 Page 62 of 804 Page 63 of 804 Page 64 of 804 Page 65 of 804 Page 66 of 804 Page 67 of 804 Page 68 of 804 Page 69 of 804 Page 70 of 804 Page 71 of 804 Page 72 of 804 Page 73 of 804 Page 74 of 804 Page 75 of 804 Page 76 of 804 Page 77 of 804 Page 78 of 804 Page 79 of 804 Page 80 of 804 Page 81 of 804 Page 82 of 804 Page 83 of 804 Page 84 of 804 Page 85 of 804 Page 86 of 804 Page 87 of 804 Page 88 of 804 Page 89 of 804 Page 90 of 804 Page 91 of 804 Page 92 of 804 Page 93 of 804 Page 94 of 804 Page 95 of 804 Page 96 of 804 Page 97 of 804 Page 98 of 804 Page 99 of 804 Page 100 of 804 Page 101 of 804 Page 102 of 804 Page 103 of 804 Page 104 of 804 Page 105 of 804 Page 106 of 804 Page 107 of 804 Page 108 of 804 Page 109 of 804 Page 110 of 804 Page 111 of 804 Page 112 of 804 Page 113 of 804 Page 114 of 804 Page 115 of 804 Page 116 of 804 Page 117 of 804 Page 118 of 804 Page 119 of 804 Page 120 of 804 Page 121 of 804 Page 122 of 804 Page 123 of 804 Page 124 of 804 Page 125 of 804 Page 126 of 804 Page 127 of 804 Page 128 of 804 Page 129 of 804 Page 130 of 804 Page 131 of 804 Page 132 of 804 Page 133 of 804 Page 134 of 804 Page 135 of 804 Page 136 of 804 Page 137 of 804 Page 138 of 804 Page 139 of 804 Page 140 of 804 Page 141 of 804 Page 142 of 804 Page 143 of 804 Page 144 of 804 Page 145 of 804 Page 146 of 804 Page 147 of 804 Page 148 of 804 Page 149 of 804 Page 150 of 804 Page 151 of 804 Page 152 of 804 Page 153 of 804 Page 154 of 804 Page 155 of 804 Page 156 of 804 Page 157 of 804 INTERLOCAL AGREEMENT FOR SWIMMING LESSONS 8LMW%KVIIQIRXMWQEHIEWSJXLICCCHE]SJCCCCCCCCCCCF]ERHFIX[IIR4EPQ&IEGL 'SYRX]E4SPMXMGEP7YFHMZMWMSRSJXLI7XEXISJ*PSVMHEF]ERHXLVSYKLMXW&SEVHSJ 'SQQMWWMSRIVWLIVIMREJXIVVIJIVVIHXSEWXLI'3928=ERH'MX]SJ&S]RXSR&IEGLE*PSVMHE QYRMGMTEPGSVTSVEXMSRPSGEXIHMR4EPQ&IEGL'SYRX]*PSVMHE LIVIMREJXIVVIJIVVIHXSEW   WHEREAS  7[MQ4VSKVEQHMWXVMFYXIWZSYGLIVWXSXLITYFPMG[LMGLQE]FIVIHIIQIHJSVW[MQQMRKPIWWSRW EXHIWMKREXIHEUYEXMGJEGMPMXMIW[MXLMR4EPQ&IEGL'SYRX]ERH  WHEREAS XLITEVXMIWHIWMVIXSIRXIVMRXSXLMW%KVIIQIRXJSV192-'-4%0-8=XS TVSZMHIW[MQQMRKPIWWSRWEWTEVXSJX VIWTSRWMFMPMXMIWVIPEXMRKXLIVIXS  WHEREAS 7IGXMSR*PSVMHE7XEXYXIWORS[REWXLI*PSVMHE-RXIVPSGEP'SSTIVEXMSR%GX SJEYXLSVM^IWPSGEPKSZIVRQIRXWXSQEOIXLIQSWXIJJMGMIRXYWISJXLIMVTS[IVF]IREFPMRK XLIQXSGSSTIVEXI[MXLSXLIVPSGEPMXMIWSREFEWMWSJQYXYEPEHZERXEKIERHXLIVIF]XSTVSZMHI WIVZMGIWERHJEGMPMXMIWXLEX[MPPLEVQSRM^IKISKVETLMGIGSRSQMGTSTYPEXMSRERHSXLIVJEGXSVW MRJPYIRGMRKXLIRIIHWERHHIZIPSTQIRXSJPSGEPGSQQYRMXMIW  NOW THEREFORE MRGSRWMHIVEXMSRSJXLIQYXYEPGSZIRERXWERHTVSQMWIWGSRXEMRIH LIVIMRXLI'3928=ERHXLI192-'-4%0-8=EKVIIEWJSPPS[W  ARTICLE 1 - SERVICES   192-'-4%0-8=WLEPPSJJIVERHTVSZMHIW[MQQMRKPIWWSRGPEWWIWXSMRHMZMHYEPW[LS TVIWIRXZSYGLIVWMWWYIHF]XLI(4'0IEVRXS7[MQ4VSKVEQ)EGLGPEWWXSFISJJIVIHERH TVSZMHIHWLEPPGSRWMWXSJEWIVMIWSJEXPIEWXWM\W[MQQMRKPIWWSRWERHWLEPPFIMHIRXMJMIHMR Exhibit A EXXEGLIHLIVIXSERHMRGSVTSVEXIHLIVIMR)\LMFMX%WLEPPWIXJSVXLXLIREQIX]TI W[MQQMRKPIZIPHEXIWPSGEXMSRQMRMQYQTEVXMGMTEXMSRVIUYMVIQIRXWMJER]ERH YWYEPERHGYWXSQEV]JIIMW XLIRXLIQE\MQYQJIIXLEX192-'-4%0-8=QE]GLEVKIZSYGLIVLSPHIVWJSVWEMHGPEWW MWMXWYWYEPERHGYWXSQEV]JIIQMRYW7EMHGPEWWIWQE]FISTIRXSXLITYFPMGERHEVIRSX VIWXVMGXIHXSZSYGLIVLSPHIVW   192-'-4%0-8=EKVIIWXSTVSZMHIERHQEMRXEMRMXWJEGMPMX]MREWEJIGPIERERHL]KMIRMGQERRIV ERHMREGGSVHERGI[MXLEPPWEJIX]ERHLIEPXLWXERHEVHWERHEPPSXLIVETTPMGEFPIPE[WERH VIKYPEXMSRW192-'-4%0-8=EKVIIWXSTVSZMHIERHQEMRXEMRMRTVSTIV[SVOMRKSVHIVEPP IUYMTQIRXRIGIWWEV]XSTVSZMHIERHQEMRXEMRXLIWIVZMGIWERHJEGMPMX]EWTVSZMHIHLIVIMR    Page 158 of 804 192-'-4%0-8=VITVIWIRXWERH[EVVERXWXLEXMXWEUYEXMGJEGMPMX]MWMRGSQTPMERGIERHWLEPP GSRXMRYIXSFIMRGSQTPMERGI[MXL7IGXMSR*PSVMHE7XEXYXIWEPPETTPMGEFPIVYPIWERH VIUYMVIQIRXWSJXLI7XEXIERH'SYRX],IEPXL(ITEVXQIRXWERHEPPSXLIVETTPMGEFPIPE[WVYPIW ERHVIKYPEXMSRW4VMSVXSI\IGYXMSRSJXLMW%KVIIQIRX192-'-4%0-8=QYWXTVSZMHIXS [LMGLQYWXIZMHIRGIEWEXMWJEGXSV]MRWTIGXMSR  192-'-4%0-8=WLEPPTIVJSVQXLIWIVZMGIWWIXJSVXLLIVIMRMREGGSVHERGI[MXLEPP ETTPMGEFPIPE[WVYPIWERHVIKYPEXMSRWERHMREGSQTIXIRXTVSJIWWMSREPWEJIERHVIWTSRWMFPI QERRIV[MXLJYPPVIKEVHJSVXLIWEJIX]SJXLITEVXMGMTERXW192-'-4%0-8=EKVIIWERH[EVVERXW XLEXEPPW[MQQMRKMRWXVYGXSVWYXMPM^IHF]192-'-4%0-8=XSTVSZMHIPIWWSRWLIVIYRHIVWLEPPFI GIVXMJMIHEWVIUYMVIHF]7IGXMSR*PSVMHE7XEXYXIWERHER]SXLIVETTPMGEFPIPE[WVYPIW ERHVIKYPEXMSRW192-'-4%0-8=WLEPPTVSZMH VITVIWIRXEXMZIYTSRVIUYIWX192-'-4%0-8=VITVIWIRXWERH[EVVERXWXLEXMXLEWMRTPEGIERH WLEPPGSRXMRYIXSQEMRXEMREHVYKJVII[SVOTPEGITSPMG]  ARTICLE 2 COMMENCEMENT AND TERM 8LMW%KVIIQIRXWLEPPGSQQIRGISR3GXSFIVERHWLEPPVIQEMRMRIJJIGXYRXMP7ITXIQFIV   ARTICLE 3 - PAYMENTS TO MUNICIPALITY  %*SVW[MQQMRKGPEWWIWTVSZMHIHF]192-'-4%0-8=MRI\GLERKIJSV(4'0IEVRXS 7[MQ4VSKVEQZSYGLIVW'3928=WLEPPTE]192-'-4%0-8=MXWYWYEPERHGYWXSQEV] Exhibit A JIITIVGPEWWEWWIXJSVXLMRLIVIXSYTXSEQE\MQYQSJTIVGPEWWWIVMIW TVSZMHIHXSEZSYGLIVLSPHIV%WTVSZMHIHMR6IWSPYXMSR2S6XLIXSXEP TE]QIRXWXSEPPW[MQQMRKPIWWSRTVSZMHIVWYXMPM^IHMRXLI(4'0IEVRXS7[MQ4VSKVEQ JSVIEGLJMWGEP]IEVWLEPPRSXI\GIIHXLIEQSYRXFYHKIXIHF]'3928=JSVXLMWTYVTSWI JSVWEMHJMWGEP]IEV  &192-'-4%0-8=WLEPPMRZSMGI'3928=QSRXLP]FEWIHSRXLIRYQFIVSJW[MQQMRK PIWWSRGPEWWIWTVSZMHIHLIVIYRHIV-RZSMGIWWLEPPMRGPYHIEPMWXSJXLIREQIWERHGSRXEGX MRJSVQEXMSRSJWXYHIRXWXS[LSQPIWWSRW[IVIEGXYEPP]TVSZMHIHXLIREQIHEXIWERH XMQIWSJXLIGPEWWIWTVSZMHIHERHER]SXLIVHSGYQIRXEXMSRHIIQIHRIGIWWEV]F] '3928=XSZIVMJ]XLEXWIVZMGIWLEZIFIIRVIRHIVIHMRGSRJSVQMX][MXLXLMW%KVIIQIRX ERHER]ETTPMGEFPI(4'0IEVRXS7[MQ4VSKVEQGVMXIVMETSPMGMIWERHTVSGIHYVIW ARTICLE 4 - TERMINATION   8LI'3928=QE]XIVQMREXIXLMW%KVIIQIRXEXER]XMQIYTSR[VMXXIRRSXMGIXSXLI 192-'-4%0-8=[MXLSV[MXLSYXGEYWIERH[MXLSYXTIREPX]HEQEKIWSVVIGSYVWIEKEMRWX '3928=192-'-4%0-8=QE]XIVQMREXIXLMW%KVIIQIRXYTSRXLMVX]HE]W  HE]W TVMSV [VMXXIRRSXMGIXSXLI'3928=    Page 159 of 804 ARTICLE 5 - PERSONNEL 8LI192-'-4%0-8=VITVIWIRXWXLEXMXLEWSV[MPPWIGYVIEXMXWS[RI\TIRWIEPPRIGIWWEV] TIVWSRRIPVIUYMVIHXSTIVJSVQXLIWIVZMGIWYRHIVXLMW%KVIIQIRX7YGLTIVWSRRIPWLEPPRSXFI IQTPS]IIWSJSVLEZIER]GSRXVEGXYEPVIPEXMSRWLMT[MXLXLI'3928=  %PPSJXLIWIVZMGIWVIUYMVIHLIVIYRHIVWLEPPFITIVJSVQIHF]XLI192-'-4%0-8=SVYRHIVMXW WYTIVZMWMSRERHEPPTIVWSRRIPIRKEKIHMRTIVJSVQMRKXLIWIVZMGIWWLEPPFIJYPP]UYEPMJMIHERHMJ VIUYMVIHEYXLSVM^IHERHTIVQMXXIHYRHIVWXEXIERHPSGEPPE[XSTIVJSVQWYGLWIVZMGIW  8LI192-'-4%0-8=[EVVERXWXLEXEPPWIVZMGIWWLEPPFITIVJSVQIHF]WOMPPIHERHGSQTIXIRX TIVWSRRIPXSXLILMKLIWXTVSJIWWMSREPWXERHEVHWMRXLIJMIPH  ARTICLE 6 - SUBCONTRACTING   192-'-4%0-8=QE]RSX[MXLSYX[VMXXIRETTVSZEPSJ'3928=WYFGSRXVEGXER]VMKLXW VIWTSRWMFMPMXMIWSVSFPMKEXMSRWYRHIVXLMW%KVIIQIRX  ARTICLE 7 - AVAILABILITY OF FUNDS 8LI'3928= 7TIVJSVQERGIYRHIVXLMW%KVIIQIRXJSVWYFWIUYIRXJMWGEP]IEVWMWGSRXMRKIRX YTSRERRYEPETTVSTVMEXMSRWJSVMXWTYVTSWIF]XLI&SEVHSJ'SYRX]'SQQMWWMSRIVWERHWYFNIGXXS XLITVSZMWMSRWSJ4EPQ&IEGL'SYRX]6IWSPYXMSR2S6 TIVJSVQERGIYRHIVXLMW%KVIIQIRXJSVWYFWIUYIRXJMWGEP]IEVWMWGSRXMRKIRXYTSRERRYEP ETTVSTVMEXMSRWJSVMXWTYVTSWIF]MXWKSZIVRMRKFSH]  ARTICLE 8 - INSURANCE   ;MXLSYX[EMZMRKXLIVMKLXXSWSZIVIMKRMQQYRMX]EWTVSZMHIHF]WJW192-'-4%0-8= EGORS[PIHKIWXSFIWIPJMRWYVIHJSV+IRIVEP0MEFMPMX]ERH%YXSQSFMPI0MEFMPMX]YRHIV*PSVMHE WSZIVIMKRMQQYRMX]WXEXYXIW[MXLGSZIVEKIPMQMXWSJ4IV4IVWSRERH4IV 3GGYVVIRGISVWYGLQSRIXEV][EMZIVPMQMXWXLEXQE]GLERKIERHFIWIXJSVXLF]XLIPIKMWPEXYVI  -RXLIIZIRX192-'-4%0-8=QEMRXEMRWXLMVHTEVX]'SQQIVGMEP+IRIVEP0MEFMPMX]ERH&YWMRIWW %YXS0MEFMPMX]MRPMIYSJI\GPYWMZIVIPMERGISJWIPJMRWYVERGIYRHIVWJW 192-'-4%0-8=WLEPPEKVIIXSQEMRXEMRWEMHMRWYVERGITSPMGMIWEXPMQMXWRSXPIWWXLER GSQFMRIHWMRKPIPMQMXJSVFSHMP]MRNYV]SVTVSTIVX]HEQEKI  192-'-4%0-8=EKVIIWXSQEMRXEMRSVXSFIWIPJSR    ;LIRVIUYIWXIH192-'-4%0-8=WLEPPEKVIIXSTVSZMHIEREJJMHEZMXSV'IVXMJMGEXISJ-RWYVERGI IZMHIRGMRKMRWYVERGIWIPJMRWYVERGIERHSVWSZIVIMKRMQQYRMX]WXEXYW[LMGL'3928=EKVIIW XSVIGSKRM^IEWEGGITXEFPIJSVXLIEFSZIQIRXMSRIHGSZIVEKIW     Page 160 of 804 'SQTPMERGI[MXLXLIJSVIKSMRKVIUYMVIQIRXWWLEPPRSXVIPMIZI192-'-4%0-8=SJMXWPMEFMPMX] ERHSFPMKEXMSRWYRHIVXLMW%KVIIQIRX   ARTICLE 9 - INDEMNIFICATION   )EGLTEVX]WLEPPFIPMEFPIJSVMXWS[REGXMSRWERHRIKPMKIRGIERHXSXLII\XIRXTIVQMXXIHF]PE[ '3928=WLEPPMRHIQRMJ]HIJIRHERHLSPHLEVQPIWW192-'-4%0-8=EKEMRWXER]EGXMSRW 192-'-4%0-8=WLEPPMRHIQRMJ]HIJIRHERHLSPHLEVQPIWW'3928=EKEMRWXER]EGXMSRW %KVIIQIRX8LIJSVIKSMRKMRHIQRMJMGEXMSRWLEPPRSXGSRWXMXYXIE[EMZIVSJWSZIVIMKRMQQYRMX] FI]SRHXLIPMQMXWWIXJSVXLMR7IGXMSR*PSVMHE7XEXYXIWRSVWLEPPXLIWEQIFIGSRWXVYIHXS [MPPJYPSVMRXIRXMSREPEGXWSVSQMWWMSRW  ARTICLE 10 - SUCCESSORS AND ASSIGNS 2IMXLIVTEVX]WLEPPEWWMKRHIPIKEXISVSXLIV[MWIXVERWJIVMXWVMKLXWERHSFPMKEXMSRWEWWIXJSVXLMR XLMW%KVIIQIRXXSER]SXLIVIRXMX][MXLSYXXLITVMSV[VMXXIRGSRWIRXSJXLISXLIVTEVX]  ARTICLE 11 - REMEDIES   8LMW%KVIIQIRXWLEPPFIKSZIVRIHF]XLIPE[WSJXLI7XEXISJ*PSVMHE%R]PIKEPEGXMSR RIGIWWEV]XSIRJSVGIXLI%KVIIQIRX[MPPFILIPHMR4EPQ&IEGL'SYRX]2SVIQIH]LIVIMR GSRJIVVIHYTSRER]TEVX]MWMRXIRHIHXSFII\GPYWMZISJER]SXLIVVIQIH]ERHIEGLERHIZIV] WYGLVIQIH]WLEPPFIGYQYPEXMZIERHWLEPPFIMREHHMXMSRXSIZIV]SXLIVVIQIH]KMZIRLIVIYRHIV SVRS[SVLIVIEJXIVI\MWXMRKEXPE[SVMRIUYMX]F]WXEXYXISVSXLIV[MWI2SWMRKPISVTEVXMEP I\IVGMWIF]ER]TEVX]SJER]VMKLXTS[IVSVVIQIH]LIVIYRHIVWLEPPTVIGPYHIER]SXLIVSV JYVXLIVI\IVGMWIXLIVISJ  2STVSZMWMSRSJXLMW%KVIIQIRXMWMRXIRHIHXSSVWLEPPFIGSRWXVYIHXSGVIEXIER]XLMVHTEVX] FIRIJMGMEV]SVXSTVSZMHIER]VMKLXWXSER]TIVWSRSVIRXMX]RSXETEVX]XSXLMW%KVIIQIRX MRGPYHMRKFYXRSXPMQMXIHXSER]GMXM^IRSVIQTPS]IIWSJXLI'3928=ERHSV192-'-4%0-8=  ARTICLE 12 - CONFLICT OF INTEREST   8LI192-'-4%0-8=VITVIWIRXWXLEXMXTVIWIRXP]LEWRSMRXIVIWXERHWLEPPEGUYMVIRSMRXIVIWX IMXLIVHMVIGXSVMRHMVIGX[LMGL[SYPHGSRJPMGXMRER]QERRIV[MXLXLITIVJSVQERGISJWIVZMGIW VIUYMVIHLIVIYRHIVEWTVSZMHIHJSVMR'LETXIV4EVX---*PSVMHE7XEXYXIWERHXLI4EPQ&IEGL 'SYRX]'SHISJ)XLMGW8LI192-'-4%0-8=JYVXLIVVITVIWIRXWXLEXRSTIVWSRLEZMRKER]WYGL GSRJPMGXSJMRXIVIWXWLEPPFIIQTPS]IHJSVWEMHTIVJSVQERGISJWIVZMGIW  8LI192-'-4%0-8=WLEPPTVSQTXP]RSXMJ]XLI'3928= WVITVIWIRXEXMZIMR[VMXMRKF] GIVXMJMIHQEMPSJEPPTSXIRXMEPGSRJPMGXWSJMRXIVIWXSJER]TVSWTIGXMZIFYWMRIWWEWWSGMEXMSR    Page 161 of 804 MRXIVIWXSVSXLIVGMVGYQWXERGI[LMGLQE]MRJPYIRGISVETTIEVXSMRJPYIRGIXLI192-'-4%0-8= 7NYHKQIRXSVUYEPMX]SJWIVZMGIWFIMRKTVSZMHIHLIVIYRHIV7YGL[VMXXIRRSXMJMGEXMSRWLEPP MHIRXMJ]XLITVSWTIGXMZIFYWMRIWWEWWSGMEXMSRMRXIVIWXSVGMVGYQWXERGIXLIREXYVISJ[SVOXLEXXLI 192-'-4%0-8=QE]YRHIVXEOIERHVIUYIWXERSTMRMSRSJXLI'3928=EWXS[LIXLIVXLI EWWSGMEXMSRMRXIVIWXSVGMVGYQWXERGI[SYPHMRXLISTMRMSRSJXLI'3928=GSRWXMXYXIEGSRJPMGX SJMRXIVIWXMJIRXIVIHMRXSF]XLI192-'-4%0-8=8LI'3928=EKVIIWXSRSXMJ]XLI 192-'-4%0-8=SJMXWSTMRMSRF]GIVXMJMIHQEMP[MXLMRXLMVX]  HE]WSJVIGIMTXSJRSXMJMGEXMSR F]XLI192-'-4%0-8=-JMRXLISTMRMSRSJXLI'3928=XLITVSWTIGXMZIFYWMRIWW EWWSGMEXMSRMRXIVIWXSVGMVGYQWXERGI[SYPHRSXGSRWXMXYXIEGSRJPMGXSJMRXIVIWXF]XLI 192-'-4%0-8=XLI'3928=WLEPPWSWXEXIMRXLIRSXMJMGEXMSRERHXLI192-'-4%0-8= WLEPPEXMXWSTXMSRIRXIVMRXSWEMHEWWSGMEXMSRMRXIVIWXSVGMVGYQWXERGIERHMXWLEPPFIHIIQIHRSX MRGSRJPMGXSJMRXIVIWX[MXLVIWTIGXXSWIVZMGIWTVSZMHIHXSXLI'3928=F]XLI192-'-4%0-8= YRHIVXLIXIVQWSJXLMW%KVIIQIRX  ARTICLE 13 - EXCUSABLE DELAYS   192-'-4%0-8=WLEPPRSXFIGSRWMHIVIHMRHIJEYPXF]VIEWSRSJER]JEMPYVIMRTIVJSVQERGIMJ WYGLJEMPYVIEVMWIWSYXSJGEYWIWVIEWSREFP]FI]SRHXLIGSRXVSPSJ192-'-4%0-8=SVMXW WYFGSRXVEGXSVWERH[MXLSYXXLIMVJEYPXSVRIKPMKIRGI7YGLGEYWIWMRGPYHIFYXEVIRSXPMQMXIHXS EGXWSJ+SHJSVGIQENIYVIREXYVEPSVTYFPMGLIEPXLIQIVKIRGMIWPEFSVHMWTYXIWJVIMKLX IQFEVKSIWERHEFRSVQEPP]WIZIVIERHYRYWYEP[IEXLIVGSRHMXMSRW  JEMPYVIXSTIVJSVQXLI[SVOERHMJXLI192-'-4%0-8= 7JEMPYVIXSTIVJSVQ[EW[MXLSYXMXWSV MXWWYFGSRXVEGXSVWJEYPXSVRIKPMKIRGIXLI%KVIIQIRXWGLIHYPIERHSVER]SXLIVEJJIGXIH TVSZMWMSRSJXLMW%KVIIQIRXWLEPPFIVIZMWIHEGGSVHMRKP]WYFNIGXXSXLI'3928= 7VMKLXWXS GLERKIXIVQMREXISVWXSTER]SVEPPSJXLI[SVOEXER]XMQI  ARTICLE 14 - ARREARS   8LI192-'-4%0-8=WLEPPRSXTPIHKIXLI'3928= 7GVIHMXSVQEOIMXEKYEVERXSVSJTE]QIRX SVWYVIX]JSVER]GSRXVEGXHIFXSFPMKEXMSRNYHKIQIRXPMIRSVER]JSVQSJMRHIFXIHRIWW8LI 192-'-4%0-8=JYVXLIV[EVVERXWERHVITVIWIRXWXLEXMXLEWRSSFPMKEXMSRSVMRHIFXIHRIWWXLEX [SYPHMQTEMVMXWEFMPMX]XSJYPJMPPXLIXIVQWSJXLMW%KVIIQIRX  ARTICLE 15 PUBLIC RECORDS  HSGYQIRXWSVSXLIVVIGSVHWVIPEXMRKXSXLMW%KVIIQIRX  ARTICLE 16 - INDEPENDENT CONTRACTOR RELATIONSHIP   8LI192-'-4%0-8=MWERHWLEPPFIMRXLITIVJSVQERGISJEPP[SVOWIVZMGIWERHEGXMZMXMIW YRHIVXLMW%KVIIQIRXER-RHITIRHIRX'SRXVEGXSVERHRSXERIQTPS]IIEKIRXSVWIVZERXSJXLI '3928=%PPTIVWSRWIRKEKIHMRER]SJXLI[SVOSVWIVZMGIWTIVJSVQIHTYVWYERXXSXLMW    Page 162 of 804 %KVIIQIRXWLEPPEXEPPXMQIWERHMREPPTPEGIWFIWYFNIGXXSXLI192-'-4%0-8= 7WSPI HMVIGXMSRWYTIVZMWMSRERHGSRXVSP8LI192-'-4%0-8=WLEPPI\IVGMWIGSRXVSPSZIVXLIQIERW ERHQERRIVMR[LMGLMXERHMXWIQTPS]IIWTIVJSVQXLI[SVOERHMREPPVIWTIGXWXLI 192-'-4%0-8= 7VIPEXMSRWLMTERHXLIVIPEXMSRWLMTSJMXWIQTPS]IIWXSXLI'3928=WLEPPFI XLEXSJER-RHITIRHIRX'SRXVEGXSVERHRSXEWIQTPS]IIWSVEKIRXWSJXLI'3928=  8LI192-'-4%0-8=HSIWRSXLEZIXLITS[IVSVEYXLSVMX]XSFMRHXLI'3928=MRER] TVSQMWIEKVIIQIRXSVVITVIWIRXEXMSR ARTICLE 17 - CONTINGENT FEES   8LI192-'-4%0-8=[EVVERXWXLEXMXLEWRSXIQTPS]IHSVVIXEMRIHER]GSQTER]SVTIVWSR SXLIVXLEREFSREJMHIIQTPS]II[SVOMRKWSPIP]JSVXLI192-'-4%0-8=XSWSPMGMXSVWIGYVIXLMW %KVIIQIRXERHXLEXMXLEWRSXTEMHSVEKVIIHXSTE]ER]TIVWSRGSQTER]GSVTSVEXMSR MRHMZMHYEPSVJMVQSXLIVXLEREFSREJMHIIQTPS]II[SVOMRKWSPIP]JSVXLI192-'-4%0-8= ER]JIIGSQQMWWMSRTIVGIRXEKIKMJXSVER]SXLIVGSRWMHIVEXMSRGSRXMRKIRXYTSRSVVIWYPXMRK JVSQXLIE[EVHSVQEOMRKSJXLMW%KVIIQIRX  ARTICLE 18 - ACCESS AND AUDITS   8LI192-'-4%0-8=WLEPPQEMRXEMREHIUYEXIVIGSVHWXSNYWXMJ]EPPGLEVKIWI\TIRWIWERHGSWXW MRGYVVIHMRIWXMQEXMRKERHTIVJSVQMRKXLI[SVOJSVEXPIEWXXLVII  ]IEVWEJXIVGSQTPIXMSRSV XIVQMREXMSRSJXLMW%KVIIQIRX8LI'3928=WLEPPLEZIEGGIWWXSWYGLFSSOWVIGSVHWERH HSGYQIRXWEWVIUYMVIHMRXLMWWIGXMSRJSVXLITYVTSWISJMRWTIGXMSRSVEYHMXHYVMRKRSVQEP FYWMRIWWLSYVWEXXLI192-'-4%0-8= 7TPEGISJFYWMRIWW  4EPQ&IEGL'SYRX]LEWIWXEFPMWLIHXLI3JJMGISJXLI-RWTIGXSV+IRIVEPMR4EPQ&IEGL'SYRX] 'SHI7IGXMSR FYXMWRSXPMQMXIHXSXLITS[IVXSVIZMI[TEWXTVIWIRXERHTVSTSWIH'SYRX]GSRXVEGXW XVERWEGXMSRWEGGSYRXWERHVIGSVHWXSVIUYMVIXLITVSHYGXMSRSJVIGSVHWERHXSEYHMXMRZIWXMKEXI QSRMXSVERHMRWTIGXXLIEGXMZMXMIWSJXLI192-'-4%0-8=MXWSJJMGIVWEKIRXWIQTPS]IIWERH PSFF]MWXWMRSVHIVXSIRWYVIGSQTPMERGI[MXLGSRXVEGXVIUYMVIQIRXWERHHIXIGXGSVVYTXMSRERH JVEYH  *EMPYVIXSGSSTIVEXI[MXLXLI-RWTIGXSV+IRIVEPSVMRXIVJIVMRK[MXLSVMQTIHMRKER]MRZIWXMKEXMSR WLEPPFIMRZMSPEXMSRSJ4EPQ&IEGL'SYRX]'SHI7IGXMSRERHTYRMWLIHTYVWYERX XS7IGXMSR*PSVMHE7XEXYXIWMRXLIWEQIQERRIVEWEWIGSRHHIKVIIQMWHIQIERSV  ARTICLE 19 - NONDISCRIMINATION   8LI192-'-4%0-8=[EVVERXWERHVITVIWIRXWXLEXEPPSJMXWIQTPS]IIWEVIXVIEXIHIUYEPP] HYVMRKIQTPS]QIRX[MXLSYXVIKEVHXSVEGIGSPSVVIPMKMSRHMWEFMPMX]WI\EKIREXMSREPSVMKMR ERGIWXV]QEVMXEPWXEXYWJEQMPMEPWXEXYWWI\YEPSVMIRXEXMSRKIRHIVMHIRXMX]ERHI\TVIWWMSRSV KIRIXMGMRJSVQEXMSR     Page 163 of 804 ARTICLE 20 - AUTHORITY TO PRACTICE   8LI192-'-4%0-8=LIVIF]VITVIWIRXWERH[EVVERXWXLEXMXLEWERH[MPPGSRXMRYIXSQEMRXEMR EPPPMGIRWIWERHETTVSZEPWVIUYMVIHXSGSRHYGXMXWFYWMRIWWERHXLEXMX[MPPEXEPPXMQIWGSRHYGXMXW FYWMRIWWEGXMZMXMIWMREVITYXEFPIQERRIV4VSSJSJWYGLPMGIRWIWERHETTVSZEPWWLEPPFIWYFQMXXIH XSXLI'3928= WVITVIWIRXEXMZIYTSRVIUYIWX  ARTICLE 21 - SEVERABILITY   -JER]XIVQSVTVSZMWMSRSJXLMW%KVIIQIRXSVXLIETTPMGEXMSRXLIVISJXSER]TIVWSRSV GMVGYQWXERGIWWLEPPXSER]I\XIRXFILIPHMRZEPMHSVYRIRJSVGIEFPIXLIVIQEMRHIVSJXLMW %KVIIQIRXSVXLIETTPMGEXMSRSJWYGLXIVQWSVTVSZMWMSRXSTIVWSRWSVGMVGYQWXERGIWSXLIVXLER XLSWIEWXS[LMGLMXMWLIPHMRZEPMHSVYRIRJSVGIEFPIWLEPPRSXFIEJJIGXIHERHIZIV]SXLIVXIVQ ERHTVSZMWMSRSJXLMW%KVIIQIRXWLEPPFIHIIQIHZEPMHERHIRJSVGIEFPIXSXLII\XIRXTIVQMXXIH F]PE[  ARTICLE 22- PUBLIC ENTITY CRIMES   %WTVSZMHIHMR*7F]IRXIVMRKMRXSXLMW%KVIIQIRXSVTIVJSVQMRKER][SVOMR JYVXLIVERGILIVISJXLI192-'-4%0-8=GIVXMJMIWXLEXMXMXWEJJMPMEXIWWYTTPMIVWWYFGSRXVEGXSVW ERHGSRXVEGXSVW[LS[MPPTIVJSVQLIVIYRHIVLEZIRSXFIIRTPEGIHSRXLIGSRZMGXIHZIRHSVPMWX QEMRXEMRIHF]XLI7XEXISJ*PSVMHE(ITEVXQIRXSJ1EREKIQIRX7IVZMGIW[MXLMRXLIQSRXLW MQQIHMEXIP]TVIGIHMRKXLIHEXILIVISJ8LMWRSXMGIMWVIUYMVIHF]*7  E   ARTICLE 23 - SURVIVABILITY   %R]GSZIRERXEKVIIQIRXVITVIWIRXEXMSR[EVVERX]SVSXLIVTVSZMWMSRSJXLMW%KVIIQIRXXLEXMW SJEGSRXMRYMRKREXYVISV[LMGLF]MXWPERKYEKISVMXWREXYVIMQTSWIWERSFPMKEXMSRXLEXI\XIRHW FI]SRHXLIXIVQSJXLMW%KVIIQIRXMRGPYHMRKFYXRSXPMQMXIHXSVITVIWIRXEXMSRWVIPEXMRKXS MRHIQRMJMGEXMSRERHXLIHMWGPSWYVISVS[RIVWLMTSJHSGYQIRXWWLEPPWYVZMZIXLII\TMVEXMSRSV IEVP]XIVQMREXMSRSJXLMW%KVIIQIRXERHXLIGSRWYQQEXMSRSJXLIXVERWEGXMSRWGSRXIQTPEXIH LIVIYRHIV  ARTICLE 24 - NOTICE   %PPRSXMGIWVIUYMVIHMRXLMW%KVIIQIRXWLEPPFIWIRXF]GIVXMJMIHQEMPVIXYVRVIGIMTXVIUYIWXIH LERHHIPMZIV]SVSXLIVHIPMZIV]WIVZMGIVIUYMVMRKWMKRIHEGGITXERGI-JWIRXXSXLI'3928= RSXMGIWWLEPPFIEHHVIWWIHXS   4EPQ&IEGL'SYRX]*MVI6IWGYI 4MOI6SEH ;IWX4EPQ&IEGL*0 %XXR*MVI6IWGYI%HQMRMWXVEXSV     Page 164 of 804 -JWIRXXSXLI192-'-4%0-8=RSXMGIWWLEPPFIEHHVIWWIHXS  .SLR(IRWSR4SSP 'MX]SJ&S]RXSR&IEGL XL 2;%ZI &S]RXSR&IEGL*P %XXR/EVM%=IVK4SSP7YTIVZMWSV      ARTICLE 25 - FILING %GST]SJXLMW%KVIIQIRXWLEPPFIJMPIH[MXLXLI'PIVOSJXLI'MVGYMX'SYVXMRERHJSV4EPQ &IEGL'SYRX]  ARTICLE 26 - ENTIRETY OF CONTRACTUAL AGREEMENT 8LI'3928=ERHXLI192-'-4%0-8=EKVIIXLEXXLMW%KVIIQIRXWIXWJSVXLXLIIRXMVI EKVIIQIRXFIX[IIRXLITEVXMIWERHXLEXXLIVIEVIRSTVSQMWIWSVYRHIVWXERHMRKWSXLIVXLERXLSWI WXEXIHLIVIMR2SRISJXLITVSZMWMSRWXIVQWERHGSRHMXMSRWGSRXEMRIHMRXLMW%KVIIQIRXQE]FI EHHIHXSQSHMJMIHWYTIVWIHIHSVSXLIV[MWIEPXIVIHYRPIWWEKVIIHXSMR[VMXMRKF]FSXLTEVXMIW 8LMW%KVIIQIRXWLEPPMRYVIXSXLIFIRIJMXSJERHWLEPPFIFMRHMRKYTSRXLITEVXMIWXLIMV VIWTIGXMZIEWWMKRWERHWYGGIWWSVWMRMRXIVIWX Remainder of page left blank intentionally.    Page 165 of 804 IN WITNESS WHEREOF, XLI&SEVHSJ'SYRX]'SQQMWWMSRIVWSJ4EPQ&IEGL'SYRX]*PSVMHELEWQEHI ERHI\IGYXIHXLMW%KVIIQIRXSRFILEPJSJXLI'3928=ERH192-'-4%0-8=LEWLIVIYRXSWIXMXWLERHXLI HE]ERH]IEVEFSZI[VMXXIR WITNESS PALM BEACH COUNTY, FLORIDA, BY ITS BOARD OF COUNTY COMMISSIONERS ______________________________ &]CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 7MKREXYVI.IJJVI]4'SPPMRW*MVI6IWGYI%HQMRMWXVEXSV XLVSYKL6SFIVX;IMWQER'SYRX]%HQMRMWXVEXSV CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 2EQI X]TISV4VMRX  APPROVED AS TO FORM APPROVED AS TO TERMS AND LEGAL SUFFICIENCY AND CONDITIONS &]CCCCCCCCCCCCCCCCCCCCCCCCCC&]CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 'SYRX]%XXSVRI]4EPQ&IEGL'SYRX]*MVI6IWGYI ATTEST:CITY OF BOYNTON BEACH  &]CCCCCCCCCCCCCCCCCCCCCCCCCCCC&]CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 'MX]'PIVO.IVV]8E]PSV1E]SV    APPROVED AS TO FORM AND LEGAL SUFFICIENCY   &]CCCCCCCCCCCCCCCCCCCCCCCCCCC 'MX]%XXSVRI]   Page 166 of 804 EXHIBIT "A"     Page 167 of 804 Page 168 of 804 Page 169 of 804 Page 170 of 804 Page 171 of 804 Page 172 of 804 Page 173 of 804 INTERLOCAL AGREEMENT INTERLOCAL AGREEMENT This is made and entered into ________________________, by and between Palm Beach County, a political subdivision of the State of CountyCity of Boynton Beach City, a municipal corporation existing under the laws of the State of Florida. WITNESSETH WHEREAS , Section 163.01, Florida Statutes, permits public agencies to enter into Interlocal Agreements to jointly exercise any power, privilege, or authority which such agencies share in common and which each might exercise separately; and WHEREAS , the County has initiated a P25 Migration Project pursuant to which the County will replace its existing public safety radio system with one that is APCO P25 compliant; and WHEREAS , the City has current public safety radio system since 2000 and desires to continue to receive the benefits of interoperability; and WHEREAS, Motorola SmartZone Controller; and WHEREAS , the City wants to replace its City owned system with an APCO P25 compliant system; and WHEREAS, the County and City jointly plan, set performance specifications and participate cooperatively in a single procurement process for the replacement of their individual radio systems; and WHEREAS , this Interlocal Agreement provides the framework for the City to make the election (or take the actions) specified in this Agreement and for the County to provide the services in relation to the City's P25 migration project as set forth herein. NOW THEREFORE , in consideration of the mutual covenants, promises and representations contained herein the parties hereto agree as follows. Section 1: Recitals The foregoing recitals are true and correct and incorporated herein by reference.  WĂŐĞĻ­ŽĨϭϱ  Page 174 of 804 Section 2: Purpose The purpose of this Agreement is to define the relationship between the County and the City by setting forth the parameters under which the County will: (1) facilitate the Package; (2) prepare an RFP for the P25 Migration Project Design Criteria Package as an Alternate; and (3) at City election and cost, contract with the Contractor for the design and installation stem. The County will perform project management services for the City. In addition, t obligations for funding third party costs and expenses Radio System. Section 3: Definitions 3.01 Alternate: A portion of the RFP which describes a discrete scope of work for which a response is mandatory, and which work must be performed by the respondent to the RFP, if City in its sole discretion makes the Radio System Election as set forth herein, despite the fact that the respondent will not know whether that discrete scope of work will actually be awarded as part of the P25 Radio System Contract. 3.02 Board: The Palm Beach County Board of County Commissioners. 3.03 CID: The Capital Improvement Division of the FDO Department. CID is responsible for the administration of the Consultant and Contractor contracts. 3.04 City: City of Boynton Beach, a municipal corporation of the State of Florida. 3.05 City Consultant Services Authorization (City CSA): Written document describing Package, 2) provide installation administration services, 3) provide project close-out services, and 4) authorize any other work, allowed pursuant to the Consultant contract, requested and approved by the City Representative. 3.06 City Contingency: Ten Percent (10%) of the cost of the City CSA and Ten Percent (10%) of the cost of the City SOW to be transferred to the County by the City; 1) at the time of City Design Criteria Election, and 2) at the time of City Radio System Election. The contingency to be transferred at the time of Radio System Election is equal to 10% of the cost of the City SOW and 10% of the costs of the installation administration services. The City Contingency can be used by the City to fund changes made necessary by; 1) requests of the City, and/or 2) errors and/or omissions of the Consultant during the design/implementation phase, and/or 3) unforeseen conditions as defined by the P25 Radio System Contract.  WĂŐĞĻ®ŽĨϭϱ  Page 175 of 804 3.07 City Design Criteria Package: T to the City CSA. The City Design Criteria Package will specify performance based criteria for the City Radio System which may include material quality standards, conceptual design, budget restrictions, schedule and other requirements to accurately reflect the required project elements such as conducting field surveys, and performing propagation analyses. 3.08 City Design Criteria Package Election: A written notification which at a minimum contains a; 1) statement that the scope of work for the City CSA is final, 2) certification that the City accepts the proposed cost for the City CSA, 3) a monetary transfer in an amount equal to 110% of the cost of the City CSA, 4) identification of the City Project Manager, and 5) certification that the City Representative has the authority to make the City Design Criteria Package Election. 3.09 City Project Manager: The Chief of Police, or his designee, that is the primary City point of contact for the County Project Manager with respect to the administration of the City CSA and the City SOW. This person shall act on behalf of the City and be responsible for making timely decisions, approvals (either approving or securing City approval), processing accounting approvals, and authorizing City initiated change orders and funding transfers. The City Project Manager shall not directly communicate with the Consultant or the Contractor but instead shall communicate with the County Project Manager unless otherwise authorized by the County Project Manager. 3.10 City Radio System: A City owned and operated P25 compliant public safety radio system. 3.11 City Radio System Budget: The total of the City CSA plus 10% contingency, the City SOW plus 10%, and any other funding that may be required by City SOW, approved by the City and transferred to the County from time to time. 3.12 City Radio System Election: A written notification which at a minimum contains a; 1) statement that the City concurs with the selection of a Contractor, 2) certification that the City accepts the scope, terms, conditions and costs of the City SOW, 3) for construction administration, 4) monetary transfer in an amount equal to 110% of the cost of the City SOW , and 5) certification that the City Representative has the authority to make the City Radio System Election. 3.13 City Representative: The City Manager or designee who has the authority of the City to obligate the City pursuant to this Agreement, after adhering to City adopted policies and procedures.  WĂŐĞĻÆŽĨϭϱ  Page 176 of 804 3.14 City Statement of Work (SOW): The specific scope of work for the City Radio System which is negotiated with the selected Contractor and, at a minimum, includes provisions describing the responsibilities of the Contractor, defining the conditions of sale, delivery, installation and acceptance testing, detailing the system parameters, identifying unit quantities, detailing the cut-over plan and containing the price and schedule for the proposed City Radio System. 3.15 Consultant: RCC Consultants Inc., a professional engineering firm awarded a continuing services agreement by the County. 3.16 Consultant Services Authorization (CSA): A written task order issued against the Consultant contract which describes the scope of services to be performed, the cost for services and the timeframe for completion. 3.17 Contractor: The properly licensed vendor awarded a contract by the County for the P25 Migration Project. 3.18 County: Palm Beach County, a political subdivision of the State of Florida. 3.19 County Project Manager: The Capital Improvement Division Director, or his designee, that is responsible for the management of the Consultant contract and the P25 Radio System Contract. 3.20 County Representative: The FDO Director, who is given the authority to obligate the County in accordance to County adopted policies and procedures. 3.21 Electronic Services and Security Division (ESS): The division of FDO responsible for administration and management of the Radio Systems. 3.22 Facilities Development & Operations Department (FDO): The County Department responsible for oversight of ESS and the design, construction, management and operation of County electronic systems under the jurisdiction of the Board. 3.23 P25 Migration Project: The replacement afety radio system (in whole or in part) to a system which is compliant with the Association of Public-Safety Communications Officials (APCO) P25 standards which includes fixed transmitting and receiving equipment, a microwave system for communications between sites, remote and prime site control and management equipment, dispatch consoles and related equipment. 3.24 P25 Radio System Contract: A binding agreement between the County and the Contractor which sets forth the requirements for the P25 Migration Project including the cost thereof.  WĂŐĞϰŽĨϭϱ  Page 177 of 804 3.25 RFP: County issued request for proposals for a P25 Migration Project which will, upon City election, include the City Design Criteria Package as an Alternate. 3.26 SmartZone Controller: The Motorola SmartZone Controller is the central computer that currently and Public Safety Trunked Radio Systems. The SmartZone Controller manages access to system features, functions, individual radio users and talk-groups. Section 4: Project Management Services 4.01 The County shall provide project management services throughout all phases of the P25 Migration Project. The County shall also provide project management services related to the City CSA and the City SOW. 4.02 The County shall have the full authority to take all actions and make all decisions necessary to prosecute the work associated with awarded contracts including In such capacity, the County shall use it best professional judgment in determining which matters are of a nature and magnitude where consultation and approval of the City Project Manager must be obtained prior to authorizing an action. In general, matters which are routinely addressed with, or require approval of ESS, will require the approval of the City Project Manager. Matters which are routinely addressed with or require the approval of the Director, Facilities Development & Operations, will require the approval of the City Representative. However, when a specific provision of this Agreement requires City approval or consultation prior to the County taking action, such specific provision shall be applied to that specific approval requirement. 4.03 Pursuant to the requirements of Section 287.055, Florida Statutes (the Competitive Negotiation Act), the County has selected RCC Communications, Inc. for a continuing contract related to the County Radio System, which includes the preparation of the design criteria package for the afety radio system to one that is in compliance with APCO P25 compliance standards. 4.04 The County shall cause the Consultant to create a vendor neutral design criteria package that will form the basis of a competitive Request for Proposals (RFP) for a contractor to implement the P25 Migration Project. The County shall conduct the RFP pursuant to County code, policies and procedures. 4.05 The County shall use its standard form contract for design and construction service authorizations and/or work orders which incorporates all provisions required by state statute, local laws or policies, including but not limited to, payment and performance bonds and insurance requirements.  WĂŐĞϱŽĨϭϱ  Page 178 of 804 4.06 The County shall negotiate the fees associated with the Consultant and/or Contractor contract and pay each Consultant and/or Contractor from the funds provided by the City for that purpose pursuant to Section 9 of the Agreement. Section 5: Design Criteria Phase 5.01 The City Project Manager and the Consultant shall develop a scope of work by which the Consultant can develop the City Design Criteria Package sufficient to allow a design-build contractor to respond to the RFP. Using the scope of work identified by the City, the County Project Manager shall negotiate the costs, which together comprise the City CSA. When the City is satisfied with the proposed City CSA, it shall provide the County with the City Design Criteria Election. The City must make the City Design Criteria Election no later than 30 days after the Effective Date of this Agreement. Upon receiving the City Design Criteria Election, the County shall enter into a City CSA on behalf of the City. 5.02 Upon County execution of the City CSA, the County and Consultant will diligently begin work on the City CSA. 5.03 The Consultant will concurrently provide the City and County Project Managers with copies of all deliverables and submittals required by the City CSA for review and comment. The County Project Manager shall meet with the City Project Manager and Consultant(s), if necessary, to review the deliverables and submittals. The Consultant shall provide the County and the Project Managers with written reports containing all comments resulting from all submittal reviews. The County and the City Project Manager shall review the written reports to ensure that the Consultant addresses each comment and incorporates changes approved by the City into the work product. 5.04 The City may make changes to the City CSA by having the City Representative request that the County Representative amend the City CSA and providing the same notification with regard to the change request as the City provided f County shall enter into an amendment to the City CSA. Funding for any City CSA amendment will be as described in Section 9. 5.05 The County Project Manager shall administer the City CSA in accordance with the Consultant Contract and the City CSA. In the event of a conflict between the Consultant Contract and the City CSA, the terms of the Consultant Contract shall prevail. 5.06 At any time during the term of this Agreement, the City may request that the County cause the Consultant to perform contract other than those provided for in the City CSA. for other  WĂŐĞϲŽĨϭϱ  Page 179 of 804 services shall be in the same format and content as the City Design Criteria Package Election. 5.07 If the City terminates this Agreement after the Consultant has delivered the Design Criteria Package to County, then the County shall provide the City Design Criteria Package to the City. Section 6: Request for Proposals (RFP) 6.01 The County shall prepare a RFP for a Contractor which includes an Alternate encompassing the CityPackage and which may be awarded to the Contractor, The RFP shall contain language clearly indicating that the City's Design Criteria Package is a mandatory component, which may , and that the unit or component prices included in the Alternate shall be identical to those unit or component prices included in the bid for the County's P25 Migration Project. The City Radio System Election may, or may not be made by the City, in its sole discretion, and the proposer will be bound by its responses to the County portion of the RFP regardless of whether the City chooses to make the City Radio System Election. 6.02 The City shall be invited and encouraged to participate in all aspects of the RFP and the selection of a Contractor, but shall not have a representative sit as a voting member of the final selection committee. If the City does not concur with the results of 6.03 Despite not having a representative of the City as a voting member of the final selection committee for the Contractor, elected officials of the City shall comply with Sec. 2-355, Palm Beach County Code of Ordinances with regard to communication with respondents to the RFP. The County Representative shall provide elected officials the same notifications with regard to the cone of silence to City elected officials as he/she does to the Board. Employees of the City shall comply with the terms of the RFP with respect to directing communications to and from potential respondents about the RFP. 6.04 by the Board, the Board may direct County Representative to begin negotiations with the selected contractor. Within 30 County staff to commence negotiations, the City Representative shall advise the County Representative as to whether the City desires that the County negotiate the selected contrCity SOW. 6.05 The County Project Manager and Consultant shall negotiate the City SOW County Project Manager shall coordinate the negotiations with the City Project Manager so that the City can reasonably participate in the negotiations.  WĂŐĞϳŽĨϭϱ  Page 180 of 804 6.06 Upon completion of the negotiations with the selected contractor for the City SOW, the County will transmit a copy of the proposed City SOW to the City for review and final comment. Concurrent with the transmittal of the City SOW, the County shall also transmit the terms pursuant to which the County will allow the City to use P25 Radio System on an on-going basis. The City shall have no more than sixty (60) calendar days from the receipt of the transmittal for the City to provide the County with the City Radio System Election. If the City chooses not to make the City Radio System Election within 60 calendar days, the County shall have the right to terminate this Agreement. Section 7: Design and Installation Phase 7.01 The County Project Manager shall conduct a pre-work conference for attendance by the Consultant, City Project Manager, the Contractor and all other interested parties. 7.02 The County Project Manager and the Consultant shall provide installation administration services described in the City CSA and the City SOW. Examples of such services are: 1) reviewing and commenting on shop drawings; 2) administering coordination meetings; 3) making recommendations on change orders; 4) measuring, estimating and calculating quantities of work and certifying estimates and vendor/installer payments; 5) performing and reporting on field testing of materials and equipment; 6) identifying and resolving technical problems encountered during implementation; 7) conducting on-site inspections of all facilities and equipment installations, certification of equipment operating parameters, verification of system integration and integration with existing systems and equipment; 8) participating in site acceptance testing, reviewing and verifying all test data to determine whether site and equipment performance is in compliance with the City SOW; and 9) participating at system acceptance testing including City after its installation. 7.03 The County Project Manager shall review the payment applications submitted by the Contractor for completeness and conformance with contract requirements, Certification of the amount(s) to be paid shall be determined with the Consultant after consultation with and approval by the City Project Manager. Copies of the applications for payment shall be sent to the City Project Manager after County approval of payment application. 7.04 The City may make changes to the City SOW by having the City Representative request that the County Representative amend the City SOW and providing the same notification with regard to the change request as the City provided for the City Radio System County shall enter into a change order to the City SOW. Funding for any amendment to the City SOW will be as described in Section 9.  WĂŐĞĻ“ŽĨϭϱ  Page 181 of 804 Section 8: Project Close-Out  8.01 The County Project Manager and the Consultant shall provide project close-out services in accordance with the City CSA and City SOW. Examples of those services are: 1) review of general accuracy of information submitted and certified by the Contractor; 2) preparation of electronic Auto CAD 2013 record drawings based on information furnished, including significant changes in the work made during implementation; 3) during final inspection assist in the development of the list of items to be completed; 4) assist with acceptance testing, system certifications and inspections to verify final completion of the list of items and the work; and 5) obtain and compile all required close-out documentation including but not limited to record drawings, approved final permits, certificates of occupancy, certificates of completion, product and contractor warranties, training material and user manuals etc. 8.02 No earlier than the successful completion of the City Radio System acceptance testing and no later than concurrent with the closeout of the P25 Radio System Contract, the County will: 1) convey, via bill of sale to the City, all assets that are the subject of the City SOW; and 2) assign all warranties to the City that are the subject of the City SOW. The exact time for conveyance and assignment will be agreed upon by the County Representative and City Representative. 8.03 The sole responsibility for maintenance of the City Radio System, and the costs thereto, shall pass to the City concurrent with the conveyance of the assets and assignment of warranties described above. 8.04 The City and the County will create a separate agreement, or amend the existing agreement, for the ongoing use of any County P25 Radio System assets. Section 9: Project Funding, Payments and Change Management 9.01 The City shall be responsible for all costs associated with the City CSA(s) and City SOW, but not be limited to, all procurement costs, the costs of frequency management services, application and permit fees to governmental entities, surveys, geotechnical investigations, field coverage testing, utility connection charges, out of pocket costs and expenses incurred by the County in the performance of, or directly related to, this Agreement, and all expenses, fees or costs that are reasonably incurred by County and/or required to complete the City CSA and City SOW. 9.02 The County is solely responsible for funding all costs or services asCounty program management services, and the City CSA and City SOW, provided however that the litigation is not the result of any action of the City.  WĂŐĞϵŽĨϭϱ  Page 182 of 804 9.03 All funds sent by the City to the County will be placed in a separate unit Boynton Beach the City Radio System Budget. All funds transferred by the City to the City Radio System Budget must not be the subject of any contractual obligations, express or implied. 9.04 All expenditures authorized by the City pursuant to this Agreement will be made from the City Radio System Budget. City Radio System Budget shall not be used for expenses pursuant to Section 9.02. 9.05 Although contingency funding will be transferred at different times throughout the Agreement, the City contingency funds are cumulative and maintained as a single contingency until the City Radio System is completed. 9.06 City acknowledges that the County will not contribute any funds to the City CSA and City Radio System, and as a result, the City is encouraged to allocate sufficient funds to allow the City to maintain its own contingency account in the event that the costs exceed the City Radio System Budget. The County Representative will immediately notify the City Representative by email at any time that the costs of the City Radio System are projected to exceed the City Radio System Budget for City approval of scope reductions or increases to the City Radio System Budget. 9.07 Change requests approved by the City which do not impact the cost of the City SOW, may be authorized by the County Project Manager on the signature of the City Project Manager. Change requests approved by the City which impact the cost of the City SOW, but which can be addressed through the use of the City Contingency, shall be authorized by the County upon the signature of the City Representative. 9.08 Change requests approved by the City which cannot be funded from the contingency and will require additional contributions from the City, shall require County email notice to the City Representative and City Project Manager along with options, if any, for resolution of the change request along with the estimated costs. The City shall select, and approve by return email to County, an option within seven (7) business days whichever is shorter. If the scope of the change requires an increase in the City Radio System Budget, City shall within twenty (20) days provide its approval of the change constituting agreement to increase the City Radio System Budget which must be accompanied by a transfer of funds sufficient for the change order and an additional 10%. 9.09 The Director of FDO shall have the authority to execute all documents pertaining to the City Radio System, without further Contract Review Committee or Board of County Commissioner review, after receiving City approval to execute the documents pursuant to this Agreement. However, all such documents shall be reviewed for legal sufficiency prior to execution by the Director of FDO.  WĂŐĞϭϬŽĨϭϱ  Page 183 of 804 9.10 One hundred (100%) of any funds remaining in the City Radio System Budget will be refunded to the City within thirty (30) days of; (1) the date of the termination of this Agreement, or (2) the date of the close-out of the P25 Radio System project, whichever is earlier. 9.11 In the event that the Contractor fails to comply with the P25 Radio System Contract requirements to cure the default, County agrees to hold City harmless from any cost beyond that which was contemplated by the scope of the City SOW at the time of default. Section 10: Liability and Insurance 10.01 The parties to this Agreement and their respective officers and employees shall not be deemed to assume any liability for the acts, omissions and negligence of the other party. Furthermore, nothing herein shall be construed as a waiver of sovereign immunity by either party, pursuant to Section 768.28, Florida Statutes. 10.02 Without waiving the right to sovereign immunity as provided by Florida Statutes Section 768.28, the parties acknowledge that they are each self-insured for general liability under Florida sovereign immunity statutes with coverage limits of $200,000 per person and $300,000 per occurrence, or such monetary waiver limits that may be established by the Florida legislature. Section 11: Term The term of this Agreement shall commence upon execution of the Agreement by the County (Effective Date) and shall extend for three (3) years or until the completion of the City Radio System, whichever is longer, unless terminated pursuant to Section 12 of this Agreement. The City and County can mutually agree to extend this Agreement for any duration acceptable to both parties. Section 12: Termination 12.01 The City and County may unilaterally terminate this Agreement as provided in other sections of this Agreement. At any time prior to the the Radio System Election, the City may, for any reason, terminate this Agreement. In the event the City terminates the Agreement, the City shall provide written notice to the County. Within 5 business days of receipt of notice, the County shall terminate the services of the Consultant pursuant to the terms of the Consultant contract and the City agrees that it will reimburse the County for all costs incurred up to the date of the termination . 12.02 Election, the County may, for any reason, terminate this Agreement by providing written notice to the City which shall be effective immediately upon receipt. The County shall  WĂŐĞĻ­Ļ­ŽĨϭϱ  Page 184 of 804 terminate the services of the Consultant pursuant to the terms of the Consultant contract and the City agrees that it will reimburse the County for all costs relating to the 12.03 In the event the County receives a City Radio System Election from the City, then thereafter, neither party shall have the right to terminate this Agreement unless the other party is in default of its obligations contained in this Agreement. Section 13: Notices Any notice given pursuant to the terms of this Agreement shall be in writing and done by Certified Mail, Return Receipt Requested. The effective date of such notice shall be the date of receipt, as evidenced by the Return Receipt. All notices shall be addressed to the following: As to the County: County Administrator 301 North Olive Avenue West Palm Beach, FL 33401 Director, Facilities Development & Operations 2633 Vista Parkway West Palm Beach, FL 33411 With a copy to: 301 North Olive Avenue West Palm Beach, Florida 33401 As to Boynton Beach: City Manager, City of Boynton Beach 100 E. Boynton Beach Blvd. Boynton Beach, FL 33425-0310 With a copy to: Chief of Police 100 East Boynton Beach Blvd. Boynton Beach, FL 33435  WĂŐĞĻ­Ļ®ŽĨϭϱ  Page 185 of 804 Section 14: Applicable Law / Enforcement Costs This Agreement shall be governed by the laws of the State of Florida. In any litigation brought by a party to this Agreement to enforce the terms of this Agreement, each party shall Section 15: Filing A copy of this Agreement shall be filed by Palm Beach County with the Clerk of the Circuit Court in and for Palm Beach County. Section 16: Delegation of Duty Nothing contained herein shall be deemed to authorize the delegation of the Constitutional or Statutory duties of any party. Section 17: Time is of the Essence Time is of the essence with respect to the performance of every provision of this Agreement in which time of performance is a factor. Section 18: Non-Discrimination The parties agree that no person shall, on the grounds of age, race, color, sex, national origin, disability, religion, ancestry, marital status, familial status, sexual orientation, gender identity and expression, or genetic information be excluded from the benefits of, or be subjected to any form of discrimination under any activity carried out by the performance of this Agreement. Section 19: Force Majeure Any party delayed by a Force Majeure Event, as defined herein, in performing under this Agreement shall use reasonable efforts to remedy the cause or causes of such Force Majeure Event. A delay due to a Force Majeure Event shall serve to toll the time to God, fire, flood, earthquake, explosion, hurricane, riot, sabotage, terrorist attack, windstorm, failure of utility service, or labor dispute. Section 20: Inspector General Audit Requirements Palm Beach County has established the Office of the Inspector General in Palm Beach County Code, Section 2-421 - 2-440, as may be amended. The Inspector General is authorized with the power to review past, present and proposed County  WĂŐĞĻ­ĻÆŽĨϭϱ  Page 186 of 804 cont includes, but is not limited to, the power to audit, investigate, monitor, and inspect the activities of entities contracting with the County, or anyone acting on their behalf, in order to ensure compliance with contract requirements and to detect corruption and fraud. Failure to cooperate with the Inspector General or interfering with or impeding any investigation shall be a violation of Palm Beach County Code, Section 2-421 - 2- 440, and punished pursuant to Section 125.69, Florida Statutes, in the same manner as a second degree misdemeanor. Section 21: Construction No party shall be considered the author of this Agreement since the parties hereto have participated in extensive negotiations and drafting and redrafting of this document to arrive at a final agreement. Thus, the terms of this Agreement shall not be strictly construed against one party as opposed to the other party based upon who drafted it. In the event that any section, paragraph, sentence, clause, or provision hereof is held by a court of competent jurisdiction to be invalid, such shall not affect the remaining portions of this Agreement and the same shall remain in full force and effect. Section 22: No Third Party Beneficiary No provision of this Agreement is intended to, or shall be construed to, create any third party beneficiary or to provide any rights to any person or entity not a party to this Agreement, including but not limited to any citizen or employees of the County and/or City. Section 23: Effective Date This Agreement shall be expressly contingent upon the approval of the City Commission of the City of Boynton Beach which must be followed by the approval of the Palm Beach County Board of County Commissioners and the Agreement shall become effective only when signed by the City Commission of the City of Boynton Beach followed by the signature of the Palm Beach County Board of County Commissioners. The remainder of this page is left intentionally blank  WĂŐĞϭϰŽĨϭϱ  Page 187 of 804 IN WITNESS WHEREOF , the parties have caused this Agreement to be executed on the day and year first written above. ATTEST: SHARON R. BOCK PALM BEACH COUNTY, a political CLERK & COMPTROLLERsubdivision of the State of Florida By: By: Deputy Clerk APPROVED AS TO FORM AND APPROVED AS TO TERMS AND LEGAL SUFFICIENCY: CONDITIONS: By: By: County Attorney Audrey Wolf, Director Facilities Development & Operations ATTEST: CITY CLERK CITY OF BOYNTON BEACH, a municipal corporation of the State of Florida By: ___________________________ By: _________________________ ______________________, City Clerk _____________________, Mayor APPROVED AS TO FORM AND LEGAL SUFFICIENCY By: ____________________________ ___________________, City Attorney  WĂŐĞϭϱŽĨϭϱ  Page 188 of 804 Page 189 of 804 Page 190 of 804 Page 191 of 804 Page 192 of 804 Service Order Form Service Order only valid for 30 days after issue date Company Information Company/Organization Name:City of Boynton Beach Company Type:CorporationDBA: Contact Information Contact TypeNameTitlePhoneFaxMobileEmail SecondaryJohn McNallyInformation561.742.6073561.609.2mcnallyj@bbfl.us AuthorizerTechnology Manager TechnicalJohn McNallyInformation561.742.6073561.609.2mcnallyj@bbfl.us Technology Manager Billing Craig RamosBilling561.742.6070ramoscm@bbfl.us Primary AuthorizerLori LaVerriereCity Manager561.742.6079laverrierel@bbfl.us TechnicalCharles A. StevensITS Network Manager561.742.6079561.742.6092561.644.4214stevensc@bbfl.us Manager Billing Details Name:City of Boynton BeachState:FL Address 1:100 E Boynton Beach BlvdPostalCode:33425 Location Address 2:County:Palm Beach City:Boynton BeachCountry:UNITED STATES Deposit Payment:P.O. #: Check #: Received By & Date: Tax Exempt: Tax Exempt Certificate Number (Attach Copy): Billing Cycle Requested:Monthly Quarterly Annual Request Start Date:Standard Initial Term Commitment:36 MonthRenewal Term Commitment:12 Months Services Fees Service CodeService DescriptionQtyMrc UnitNrc UnitMRCNRC COL-BOC-DIA-50BColocation - Boca - Internet Access (50 Mbps Burst)1$380.00$0.00$380.00$0.00 COL-BOC-LIC-HC900Colocation - Boca (Half Cabinet License, Datacenter 900)1$250.00$250.00$250.00$250.00 COL-BOC-PWRP-20/120Colocation - Boca (20 Amps, 120V, Primary)1$300.00$150.00$300.00$150.00 SPA-MSC-PROSpecial Allowance - Promotion-($430.00)-($400.00) Total:$500.00$0.00 All figures exclude any applicable Federal, State and Local Taxes or Telecommunications Regulatory Fees Location Information Address 1:3500 NW Boca Raton Blvd.Name:Host.net Address 2:Suite 900NPA/NXX: City:Boca RatonDemarc: Install 1 State:FLSite Contact Name: PostalCode:33431Site Contact Phone: County:Palm BeachSite Contact Email: Country:UNITED STATES Technical Details CPE Provided by Host.net?Yes No IP Address Space Requested:1 6 14 or more (14 or more require IP justification form)No IP Existing IP Media Type Hand Off:Ethernet: Cat5 Cat6 Fiber: Single Mode Multi Mode DNS:Primary Secondary Additional Services:DHCP NAT BGP Domain(s): Notes: Burst/Additional Usage: 1. COL-BOC-DIA-50B - Internet access usage above base bandwidth will be billed at $12.00 per Mbps, based on the 95th percentile standard. Unless otherwise stated, burst capacity is equal to three times the base bandwidth or maximum port speed, whichever is less. Page 193 of 804 Page 1/210/21/14 11:53:29 AM v.9105433.103 Special Instructions This Service Order may include one or more Attachments containing additional terms and conditions related to the Licenses and/or Services ordered by Customer, all of which are incorporated by reference herein. All such Attachments are hereby incorporated by reference and included as a part of this Service Order. 1. Set up Half Cabinet with 50Mbps DIA and 20Amp/120v Power. 2. Host.net will provide Standard PDU. Please review and sign the attached Master Services Agreement ("Agreement"). This Service Order is not effective unless and until both parties have executed this Service Order and all other applicable pages which form a part of the Agreement and relate to the Service(s) or License(s) described herein. Customer Authorized Signature: Printed Name:Lori LaVerriere Title:City Manager Date: Please scan and email all signed documents to orders@host.netor fax all pages to 561.869.3321 and send Originals to our Boca Raton office at 3500 NW Boca Raton Blvd., Building 900, Boca Raton, FL 33431 Thank You! We appreciate your business! Internal Use Only SO#:9105433.103 Host.net Rep:kalexanderAccount Name:Date Submitted: Order Type:New Renewal Upgrade Add-On Change of Fees Change of Service Relocation Corrections Deposit Received by:Deposit Details: Agent/Partner Rep:Transport Provider:Lead Pass Rep: Host.net Authorized Signature:Date: Page 194 of 804 Page 2/210/21/14 11:53:29 AM v.9105433.103 1%78)67)6:-')7%+6))1)28 &VSEHFERH32)00' 8,-7%+6))1)28HEXIHEWSJCC d)JJIGXMZI(EXIe MWF]ERHFIX[IIR E(IPE[EVIPMQMXIHPMEFMPMX]GSQTER]HFE,SWXRIX[MXLEREHHVIWWEX2;&SGE6EXSR&PZH7XI&SGE6EXSR*0 d,SWXe ERHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 'YWXSQIV2EQI  7XEXISJMRGSVSVK  X]TISJIRXMX]   [MXLEREHHVIWWEX d'YWXSQIVe  ;-82)77)8, ;,)6)%7,SWXTVSZMHIWSVVIWIPPW E 1IXVS)XLIVRIX-RXIVRIXEGGIWW XVERWMX 1YPXMREXMSREP8VERWTSVX1YPXMTVSXSGSP 0EFIP7[MXGLMRK 1407 *VEQI6IPE]1EREKIH-RXIVRIX 1-7 4SMRXXS4SMRX3'\3R2IXERH(70WIVZMGIW GSPPIGXMZIP]d2IX[SVO 7IVZMGIWe  F IRXIVTVMWIZMVXYEPWSPYXMSRWEPWSORS[REWTVMZEXIGPSYHGSQTYXMRK GSPPIGXMZIP]d:MVXYEP7IVZMGIWe  G ZSMGISZIV -RXIVRIX4VSXSGSPWIVZMGIW GSPPIGXMZIP]d:S-47IVZMGIWe  H QEREKIHWIGYVMX]WIVZMGIW GSPPIGXMZIP]d1EREKIH7IGYVMX]7IVZMGIWe  I  HEXEERHRIX[SVOFEGOYTVIWXSVIWIVZMGIW GSPPIGXMZIP]d&EGOYT7IVZMGIWe J HEXEWXSVEKIWIVZMGIW GSPPIGXMZIP]d7XSVEKI7IVZMGIWe  ERH K HMWXVMFYXIHHIRMEPSJWIVZMGIQSRMXSVMRKERHQMXMKEXMSRWIVZMGIW GSPPIGXMZIP]d((371MXMKEXMSR7IVZMGIWe  IEGLEd7IVZMGIe GSPPIGXMZIP]XLI7IVZMGIWe  ;,)6)%7MREHHMXMSR,SWXPMGIRWIWWTEGIEX,SWXcWJEGMPMXMIW IEGLEd*EGMPMX]e JSVYWIF]PMGIRWIIW E MRGSRRIGXMSR[MXL XLIGSPSGEXMSRSJXIPIGSQQYRMGEXMSRWERHSV-8IUYMTQIRX Ed'SPSGEXMSR0MGIRWIe ERH F EWXIQTSVEV]SJJMGIWTEGIHYVMRKXMQIW [LIREPMGIRWIIcWTVMQEV]SJJMGIWTEGIMWYRMRLEFMXEFPIHYIXSREXYVEPSVQERQEHIHMWEWXIV Ed(MWEWXIV6IGSZIV]0MGIRWIe  IEGLE d0MGIRWIeGSPPIGXMZIP]XLId0MGIRWIWe ERH  ;,)6)%7'YWXSQIVHIWMVIWXSSFXEMRSRISVQSVISJXLI7IVZMGIWERHSV0MGIRWIWERH,SWXHIWMVIWXSTVSZMHI'YWXSQIV [MXLWYGL7IVZMGIWERHSV0MGIRWIWTYVWYERXXSXLMW1EWXIV7IVZMGIW%KVIIQIRX[LMGLMWGSQTVMWIHSJXLIJSPPS[MRKHSGYQIRXW GSPPIGXMZIP]XLMWd%KVIIQIRXe   XLMWGSZIVTEKI  XLIKIRIVEPXIVQWERHGSRHMXMSRWEXXEGLIHXSXLMWGSZIVTEKI d8IVQWERH'SRHMXMSRWe   XLIEHHIRHYQETTPMGEFPIXSIEGLX]TISJ7IVZMGISV0MGIRWIYXMPM^IHF]'YWXSQIV IEGLERd%HHIRHYQe   JYPP]I\IGYXIH7IVZMGI3VHIV W  IEGLEd7IVZMGI3VHIVe   ,SWXcW%GGITXEFPI9WI4SPMG] HIWGVMFIHMR7IGXMSRSJXLI8IVQWERH'SRHMXMSRW ERH  ,SWXcW7IVZMGI0IZIP%KVIIQIRX HIWGVMFIHMR7IGXMSRSJXLI8IVQWERH'SRHMXMSRW  23;8,)6)*36)MRGSRWMHIVEXMSRSJXLIQYXYEPGSZIRERXWLIVIMRERHJSVSXLIVKSSHERHZEPYEFPIGSRWMHIVEXMSRXLI VIGIMTXERHWYJJMGMIRG]SJ[LMGLEVILIVIF]EGORS[PIHKIHXLITEVXMIWLIVIXSMRXIRHMRKXSFIPIKEPP]FSYRHLIVIF]EKVIIEWJSPPS[W )%',4%68=,%76)%(92()678%2(7%2(%+6))783&)&392(&=)%',%2():)6= 463:-7-323*8,)(3'91)287()7'6-&)(%&3:);,-','300)'8-:)0='3146-7)8,-7 %+6))1)28 4PIEWIWMKRXLMWTEKIERHXLI7IVZMGI3VHIV W -REHHMXMSRTPIEWIMRMXMEPIEGLTEKISJXLIEXXEGLIH8IVQWERH'SRHMXMSRW IEGLETTPMGEFPI%HHIRHYQERHXLIJMVWXTEKISJXLI7IVZMGI3VHIV  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC &63%(&%2(32)00'HFE,3782)8 4VMRX'YWXSQIV)RXMX]2EQI &] &]  4VMRXIH2EQI 4VMRXIHREQI 8MXPI 8MXPI (EXI (EXI 4EKISJ  Page 195 of 804 8IVQWERH'SRHMXMSRW HMWTYXIHERHYRHMWTYXIH SRSVFIJSVIXLIHEXIWYGL TE]QIRXMWHYI MM 'YWXSQIVTVIWIRXWE[VMXXIRWXEXIQIRX SJXLITYVTSVXIHFMPPMRKHMWGVITERGMIWXS,SWXMRVIEWSREFPI 7GSTIERH4VMSVMX]SJ(SGYQIRXW8LIWI8IVQW HIXEMPSRSVFIJSVIXLI6IGSRGMPMEXMSR(EXIERH MMM  ERH'SRHMXMSRWKSZIVRXLIVIPEXMSRWLMTFIX[IIRXLI 'YWXSQIVRIKSXMEXIWMRKSSHJEMXL[MXL,SWXJSVXLITYVTSWI TEVXMIW[MXLVIWTIGXXSXLI7IVZMGIWERH0MGIRWIW SJVIWSPZMRKWYGLHMWTYXI-RXLIIZIRXWYGLHMWTYXIMW VIKEVHPIWWSJXLIX]TI W SJ7IVZMGIWSV0MGIRWIW QYXYEPP]EKVIIHYTSRERHVIWSPZIHMRJEZSVSJ'YWXSQIV TYVGLEWIHF]'YWXSQIV)EGL%HHIRHYQEXXEGLIH 'YWXSQIV[MPPVIGIMZIEGVIHMXJSVXLIHMWTYXIHGLEVKIW,SWX LIVIXSGSRXEMRWEHHMXMSREPTVSZMWMSRWWTIGMJMGEPP]VIPEXIH WLEPPRSXFISFPMKEXIHXSGSRWMHIVER]'YWXSQIVRSXMGISJER] XSETEVXMGYPEV7IVZMGISV0MGIRWITYVGLEWIHF] FMPPMRKHMWGVITERGMIWVIGIMZIHF],SWXEJXIVXLI 'YWXSQIV7IVZMGI3VHIVWGSRXEMRQSVIWTIGMJMGHIXEMPW 6IGSRGMPMEXMSR(EXI VIPEXIHXSXLI7IVZMGIWSV0MGIRWIWTYVGLEWIHF] 'YWXSQIV8LIJSPPS[MRKSVHIVSJTVIGIHIRGIWLEPPFI G 'VIHMX6IZMI[&]I\IGYXMRKXLMW%KVIIQIRX JSPPS[IHMRVIWSPZMRKER]GSRJPMGXWFIX[IIRXLIXIVQWSJ 'YWXSQIVLIVIF]EYXLSVM^IW,SWXXSGSRHYGXER XLMW%KVIIQIRXJMVWXXLIWI8IVQWERH'SRHMXMSRW MRZIWXMKEXMSRERHGVIHMXGLIGOSR'YWXSQIV[MXLER]SRISV WIGSRHXLIETTPMGEFPI%HHIRHYQERHXLMVHXLI QSVISJXLIQENSVGVIHMXVITSVXMRKEKIRGMIW'YWXSQIVWLEPP ETTPMGEFPI7IVZMGI3VHIVTVSZMHIHXLEXXLIQSWXVIGIRX VIEWSREFP]GSSTIVEXI[MXL,SWXXSSFXEMRGVIHMXMRJSVQEXMSR 7IVZMGI3VHIVWLEPPWYTIVWIHIER]TVMSV7IVZMGI3VHIV %GGITXERGISJXLMW%KVIIQIRXERHSVER]7IVZMGI3VHIVF] VIKEVHMRKXLIWEQI7IVZMGIWSV0MGIRWIYRPIWWSXLIV[MWI ,SWXGERFIWYFNIGXXSEWEXMWJEGXSV]GSQTPIXMSRSJEGVIHMX WIXJSVXLXLIVIMR VIZMI[,SWXVIWIVZIWXLIVMKLXXS[MXLLSPHMRMXMEXMSRSVJYPP MQTPIQIRXEXMSRSJER]SVEPP7IVZMGIWERH0MGIRWIWYRHIV 8IVQ8LIXIVQSJXLMW%KVIIQIRXWLEPP XLMW%KVIIQIRXTIRHMRK,SWXcWMRMXMEPWEXMWJEGXSV]GVIHMX E GSQQIRGIEWSJXLIPEXIVSJXLI)JJIGXMZI(EXIERH VIZMI[ERHETTVSZEPXLIVISJ[LMGLQE]FIGSRHMXMSRIH XLIHEXISJ,SWXcWEGGITXERGISJER]7IVZMGI3VHIV YTSRXIVQWWTIGMJMIHF],SWXMRXLIETTPMGEFPI7IVZMGI I\IGYXIHERHHIPMZIVIHF]'YWXSQIVLIVIYRHIVERH F  3VHIVMRGPYHMRKFYXRSXPMQMXIHXSWIGYVMX]JSVTE]QIRXW GSRXMRYIJSVWSPSRKEWER]7IVZMGI8IVQ EWLIVIEJXIV HYILIVIYRHIVMRXLIJSVQSJEGEWLHITSWMXSVSXLIVQIERW HIJMRIH SV0MGIRWI8IVQ EWLIVIEJXIVHIJMRIH WLEPP ,SWXVIWIVZIWXLIVMKLXXSQSHMJ]MXWVIUYMVIQIRXWMJER] VIQEMRMRIJJIGX7YFNIGXXSXLISXLIVTVSZMWMSRWSJXLMW [MXLVIWTIGXXSER]WIGYVMX]SVSXLIVEWWYVERGITVSZMHIHF] %KVIIQIRXXLIXIVQHYVMRK[LMGL'YWXSQIVWLEPPFI 'YWXSQIVJSVTE]QIRXWHYILIVIYRHIVMRPMKLXSJ SFPMKEXIHXSTYVGLEWIETEVXMGYPEV7IVZMGITVSZMHIHF] 'YWXSQIV WEGXYEPTYVGLEWIZSPYQI[LIRGSQTEVIHXS ,SWX MRGPYHMRKER]I\XIRWMSRSVVIRI[EPXLIVISJE TVSNIGXIHTYVGLEWIZSPYQIWYTSR[LMGLER]WIGYVMX]SV d7IVZMGI8IVQe ERHXLIXIVQGSZIVIHF]ER]0MGIRWI EWWYVERGIVIUYMVIQIRX[EWFEWIHSVMJ,SWXHIXIVQMRIWMR KVERXIHLIVIYRHIV MRGPYHMRKER]I\XIRWMSRSVVIRI[EP MXWWSPINYHKQIRXXLEX'YWXSQIVPEGOWSVQE]MRXLIJYXYVI XLIVISJEd0MGIRWI8IVQe WLEPPFIHIXIVQMRIHMR PEGOXLIJMRERGMEPVIWSYVGIWXSQIIXMXWSFPMKEXMSRWXS,SWX EGGSVHERGI[MXLXLIETTPMGEFPI7IVZMGI3VHIV W ERH %HHIRHE (IJEYPX 'LEVKIWERH4E]QIRXJSV7IVZMGIWERH E )ZIRXWSJ(IJEYPX)EGLSJXLIJSPPS[MRK 0MGIRWIW WLEPPGSRWXMXYXI'YWXSQIVcWHIJEYPXYRHIVXLMW%KVIIQIRX M MJ'YWXSQIVJEMPWXSQEOIER]TE]QIRXSRSVFIJSVIXLI E *IIW'YWXSQIVWLEPPTE]EPPJIIWERH ETTPMGEFPIHYIHEXILIVIYRHIV d(YI(EXIe  MM MJ GLEVKIWS[MRKTYVWYERXXSER]TVSZMWMSRSJXLMW 'YWXSQIVFIGSQIWXLIWYFNIGXSJEZSPYRXEV]TIXMXMSRMR %KVIIQIRX GSPPIGXMZIP]d*IIWe MRWYGLEQSYRXWEX FEROVYTXG]SVER]ZSPYRXEV]TVSGIIHMRKVIPEXMRKXS WYGLXMQIWERHMRWYGLQERRIV W EWQE]FIWTIGMJMIH MRWSPZIRG]VIGIMZIVWLMTPMUYMHEXMSRSVEREWWMKRQIRXJSV LIVIMR)\GITXEWSXLIV[MWIWTIGMJMIHMRXLMW XLIFIRIJMXSJGVIHMXSVWSVFIGSQIWXLIWYFNIGXSJER %KVIIQIRXEPP*IIWS[MRKMRVIWTIGXSJ7IVZMGIWERH MRZSPYRXEV]TIXMXMSRMRFEROVYTXG]SVER]MRZSPYRXEV] 0MGIRWIWWLEPPFITEMHMREHZERGISRSVFIJSVIXLIJMVWX TVSGIIHMRKVIPEXMRKXSMRWSPZIRG]VIGIMZIVWLMTPMUYMHEXMSR HE]SJIEGLERHIZIV]GEPIRHEVQSRXLHYVMRKXLI SVGSQTSWMXMSRJSVXLIFIRIJMXSJGVIHMXSVWMJWYGLTIXMXMSR ETTPMGEFPI7IVZMGI8IVQSV0MGIRWI8IVQXSXLISJJMGIW SVTVSGIIHMRKMWRSXHMWQMWWIH[MXLMRWM\X]  HE]WSJ SJ,SWX[MXLSYXER]HIQERHHIHYGXMSRVIZMWMSRSVWIX JMPMRK MMM MJ'YWXSQIVZMSPEXIW,SWXcW%GGITXEFPI9WI SJJ[LEXWSIZIV-REHHMXMSRXSER]SXLIVVIQIH]XLEX 4SPMG]XLIRMRIJJIGXSV MZ MJXLI'YWXSQIVFVIEGLIWER] QE]FIEZEMPEFPIXS,SWX[LIXLIVEXPE[SVEXIUYMX] SXLIVXIVQSVGSRHMXMSRSJXLMW%KVIIQIRXERHJEMPWXSGYVI 'YWXSQIVWLEPPTE],SWXEJMJX]HSPPEV  JIIJSVER] WYGLFVIEGL[MXLMRXIR  HE]WEJXIVRSXMGISJXLIWEQI HMWLSRSVIHGLIGOMRGPYHMRK[MXLSYXPMQMXEXMSRXLSWI VIXYVRIHJSVMRWYJJMGMIRXJYRHWXSVIMQFYVWI,SWXJSVEPP F )JJIGXSJ(IJEYPX-RXLIIZIRX'YWXSQIVWLEPP GSWXWERHEHQMRMWXVEXMZII\TIRWIWMRGYVVIH FIMRHIJEYPXSJXLMW%KVIIQIRX,SWXEXMXWWSPISTXMSRMR EHHMXMSRXSER]SXLIVVMKLXWERHVIQIHMIWEZEMPEFPIXS,SWX F (MWTYXIW'YWXSQIVWLEPPLEZIXLIVMKLX YRHIVER]SXLIVTVSZMWMSRSJXLMW%KVIIQIRXSVEXPE[SVMR XSVIEWSREFP]HMWTYXIER]SJXLIGLEVKIWGSRXEMRIHMRER IUYMX]WLEPPFIIRXMXPIHXSER]SRISVQSVISJXLIJSPPS[MRK MRZSMGIJSVETIVMSHSJXLMVX]  HE]WEJXIVXLIHEXISJ VIQIHMIW M MQQIHMEXIP]WYWTIRHER]SVEPP7IVZMGIW XLIMRZSMGI XLId6IGSRGMPMEXMSR(EXIe TVSZMHIHXLEX ERHSV0MGIRWIWERHVIPEXIHVMKLXWTVSZMHIHSVKVERXIH M ,SWXVIGIMZIWTE]QIRXMRJYPPJSVEPPGLEVKIW FSXL CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 196 of 804 LIVIYRHIV MM XIVQMREXIXLMW%KVIIQIRXMR[LMGLGEWIERHVIKYPEXSV]JIIWERHWYVGLEVKIW[LMGLQE]FIPIZMIHSV EPPSJ'YWXSQIVcWSFPMKEXMSRWYRHIVXLMW%KVIIQIRXWLEPPEWWIWWIHYTSRXLI7IVZMGIWSVXLI0MGIRWIW'YWXSQIVWLEPP EGGIPIVEXIERHFIGSQIMQQIHMEXIP]HYIERHTE]EFPIFIWSPIP]VIWTSRWMFPIJSVTE]QIRXSJER]ERHEPPWYGLXE\IW ERHEPP7IVZMGI8IVQWERH0MGIRWI8IVQWWLEPPFIERHVIKYPEXSV]JIIW%R]GEPGYPEXMSRIVVSVWMREWWIWWQIRX HIIQIHGSRGYVVIRXP]XIVQMREXIHERHSV MMM XIVQMREXIERHSVXE\VEXIGLERKIWVIUYMVMRKEHNYWXIHXE\GSQTYXEXMSRW ER]7IVZMGI8IVQERHSV0MGIRWI8IVQMR[LMGLGEWIF],SWXEWRIGIWWEV]XSEGGYVEXIP]ERHTVSTIVP]GSPPIGX EPPSJ'YWXSQIVcWSFPMKEXMSRW[MXLVIWTIGXXSWYGLXE\IWHSIWRSXVIPMIZI'YWXSQIVSJMXWVIWTSRWMFMPMX]XSVIQMX 7IVZMGISV0MGIRWIWLEPPEGGIPIVEXIERHFIGSQIXE\TE]QIRXWJYPP][LIRFMPPIH%R]JEMPYVIXSTE]WYGL MQQIHMEXIP]HYIERHTE]EFPI-REHHMXMSRJSVEXE\IWSVVIKYPEXSV]JIIWSVWYVGLEVKIWWLEPPGSRWXMXYXIE TE]QIRXHIJEYPXEPPEQSYRXWXLEXVIQEMRYRTEMHJMZI  HIJEYPXYRHIVXLMW%KVIIQIRXERH,SWXWLEPPLEZIXLI HE]WEJXIVXLIETTPMGEFPI(YI(EXIWLEPPFIWYFNIGXXSEVIQIHMIWEZEMPEFPIWIXJSVXLMRXLMW%KVIIQIRXMRIUYMX]SV XLMVX]JMZIHSPPEV  PEXITE]QIRXJIIERHSVWLEPPEXGSQQSRPE[ EGGVYIMRXIVIWXEXEVEXISJSRIERHSRILEPJTIVGIRX  TIVQSRXLSVXLILMKLIWXVEXIEPPS[IHF]%GGITXEFPI9WI4SPMG]'YWXSQIVEKVIIWXLEX ETTPMGEFPIPE[[LMGLIZIVMWPS[IV-RXLIIZIRXER]'YWXSQIVERHSVER]SXLIVVIWIPPIVSVIRHYWIVSFXEMRMRK 7IVZMGISV0MGIRWIMWWYWTIRHIHHYIXS'YWXSQIVcW7IVZMGIWHMVIGXP]SVMRHMVIGXP]JVSQ'YWXSQIVWLEPPEXEPP HIJEYPXSJMXWSFPMKEXMSRWYRHIVXLMW%KVIIQIRXXMQIWYWIXLI7IVZMGIWERHI\IVGMWIEPPVMKLXWYRHIVXLI 'YWXSQIVWLEPPTE],SWXEVIGSRRIGXMSRJIIEX,SWXcW0MGIRWIWMRGSQTPMERGI[MXL,SWXcW%GGITXEFPI9WI4SPMG] XLIRGYVVIRXVEXIWXSVIIREFPI7IVZMGISVVIWXSVIXLI d%94e EWEQIRHIHJVSQXMQIXSXMQIF],SWX8LI 0MGIRWIGYVVIRXZIVWMSRSJ,SWXcW%94MWWIXJSVXLEX [[[LSWXRIXEYT [[1560,1210,2191,1249][8][,,][Arial]][LMGL%94MWMRGSVTSVEXIHMRXSXLMW G )JJIGXSJ)\TMVEXMSRSV8IVQMREXMSR%KVIIQIRXF]XLMWVIJIVIRGI%R]EQIRHQIRXWXSXLI%94 9TSRXLII\TMVEXMSRSVXIVQMREXMSRJSVER]VIEWSRSJER]WLEPPFIIJJIGXMZIYTSRTSWXMRKEX,SWXcWWMXISRXLI;SVPH 7IVZMGI8IVQVIPEXIHXSER]7IVZMGIW d%JJIGXIH;MHI;IF'YWXSQIVLEWVIEHYRHIVWXERHWERHEKVIIWXS 7IVZMGIWe SVER]0MGIRWI8IVQVIPEXIHXSER]0MGIRWIFIFSYRHF]EPPXLIXIVQWERHGSRHMXMSRWSJWYGL%94EW d%JJIGXIH0MGIRWIe MREHHMXMSRXSER]GSRWIUYIRGIWEQIRHIHJVSQXMQIXSXMQI9TSRRSXMGIXS'YWXSQIV,SWX HIWGVMFIHIPWI[LIVIMRXLMW%KVIIQIRXSVSGGYVVMRKF]QE][MXLSYXPMEFMPMX]XS'YWXSQIVQSHMJ]SVWYWTIRHER] STIVEXMSRSJPE[XLIJSPPS[MRKWLEPPETTP] M ,SWXQE]7IVZMGISV0MGIRWIMRXLIIZIRXXLEX,SWXMRMXWWSPI MQQIHMEXIP]GIEWITVSZMHMRKER]WYGL%JJIGXIHHMWGVIXMSRHIXIVQMRIWXLEXWYGLEGXMSRQE]FIRIGIWWEV]XS 7IVZMGIWERHMQQIHMEXIP]VIZSOIER]%JJIGXIHGSQTP][MXLER]PE[SVVIKYPEXMSRMRGPYHMRK[MXLSYX 0MGIRWIW MM ER]ERHEPPTE]QIRXSFPMKEXMSRWSJPMQMXEXMSRXLI(MKMXEP1MPPIRRMYQ'ST]VMKLX%GXSJ 'YWXSQIV[MXLVIWTIGXXSWYGL%JJIGXIH7IVZMGIWERHSV97''YWXSQIVcWYWISJSVTVIWIRGISRSXLIV %JJIGXIH0MGIRWIWEWXLIGEWIQE]FI[MPPFIGSQIRIX[SVOWQE]VIUYMVIETTVSZEPSJXLIVIWTIGXMZIRIX[SVO MQQIHMEXIP]HYIERHTE]EFPI MMM MJXLII\TMVEXMSRSVEYXLSVMXMIWERHQE]FIWYFNIGXXSER]EGGITXEFPIYWEKI XIVQMREXMSRETTPMIWXSXLIIRXMVI%KVIIQIRX[MXLMRXIRTSPMGMIWIWXEFPMWLIHF]XLSWIRIX[SVOSTIVEXSVW'YWXSQIV  HE]WEJXIVWYGLI\TMVEXMSRSVXIVQMREXMSR'YWXSQIV[MPPRSXLSPH,SWXVIWTSRWMFPIJSVERH,SWXI\TVIWWP] WLEPPVIXYVRXS,SWXEPP'SRJMHIRXMEP-RJSVQEXMSRSJ,SWXHMWGPEMQWEPPPMEFMPMX]JSV'YWXSQIVcWZMSPEXMSRSJWYGL MR'YWXSQIVcWTSWWIWWMSRERH[MPPRSXQEOISVVIXEMRTSPMGMIW ER]GSTMIWSJWYGL'SRJMHIRXMEP-RJSVQEXMSR-JER] ,SWXIUYMTQIRX[EWQEHIEZEMPEFPIXS'YWXSQIVF]0E[)RJSVGIQIRX-JER]KSZIVRQIRXEPEYXLSVMX] ,SWXMRGSRRIGXMSR[MXLER]WYGL%JJIGXIH7IVZMGISVVIUYIWXWMRJSVQEXMSRGSRGIVRMRKXLIYWISJ,SWXcW7IVZMGIW %JJIGXIH0MGIRWI'YWXSQIVWLEPPVIXYVRXS,SWXEPPWYGLSV*EGMPMX]F]'YWXSQIVERHSVER]VIWIPPIVSVIRHYWIV IUYMTQIRX[MXLMRXIR  HE]WEJXIVWYGLXIVQMREXMSRSVSFXEMRMRK7IVZMGIWHMVIGXP]SVMRHMVIGXP]JVSQ'YWXSQIVSV I\TMVEXMSR-RXLIIZIRX'YWXSQIVWLEPPJEMPXSVIXYVR,SWXLEWVIEWSRXSFIPMIZIXLEX'YWXSQIVSVER]SXLIV ER]WYGLIUYMTQIRXXS,SWX[MXLMRWYGLHE]TIVMSHTIVWSRMWYWMRKXLI7IVZMGIWSVER]*EGMPMX]JSVMRETTVSTVMEXI XLIR'YWXSQIVWLEPPTE]XS,SWXYTSR[VMXXIRHIQERHSVMPPIKEPEGXMZMXMIWXLIR'YWXSQIVLIVIF]EYXLSVM^IW,SWX EREQSYRXIUYEPXS SJXLIVITPEGIQIRXGSWXSJXSGSSTIVEXI[MXLER]ETTPMGEFPIKSZIVRQIRXEPEYXLSVMXMIW WYGLIUYMTQIRX MRGPYHMRKWLMTTMRKTVSGIWWMRKERHMRGPYHMRKF]TVSZMHMRKER]ERHEPPVIUYIWXIHMRJSVQEXMSR LERHPMRK EWHIXIVQMRIHF],SWXMRMXWWSPIHMWGVIXMSR[MXLSYXJYVXLIVGSRWIRXJVSQSVRSXMJMGEXMSRXS'YWXSQIV 8LII\TMVEXMSRSVXIVQMREXMSRSJXLMW%KVIIQIRX[MPPRSX'YWXSQIVEKVIIWXLEXWYGLMRJSVQEXMSRQE]MRGPYHI ] I\XMRKYMWLGPEMQWSVPMEFMPMX] MRGPYHMRK[MXLSYX[MXLSYXPMQMXEXMSR'YWXSQIVcWEWWMKRIH-4RYQFIVW PMQMXEXMSRJSVTE]QIRXWHYI EVMWMRKTVMSVXSWYGLEGGSYRXLMWXSV]ERHEGGSYRXYWI I\TMVEXMSRSVXIVQMREXMSRSV ^ I\XMRKYMWLGPEMQWSV PMEFMPMXMIWEVMWMRKEJXIVWYGLI\TMVEXMSRSVXIVQMREXMSRMJ7IVZMGI0IZIP%KVIIQIRX,SWXWLEPPTVSZMHIXLI WYGLGPEMQWSVPMEFMPMXMIWWTIGMJMGEPP]WYVZMZIER]7IVZMGIWMREGGSVHERGI[MXLXLI,SWX7IVZMGI0IZIP I\TMVEXMSRSVXIVQMREXMSREWWIXJSVXLLIVIMR%KVIIQIRX XLId70%e EWEQIRHIHJVSQXMQIXSXMQIXLI GYVVIRXZIVWMSRSJ[LMGLMWWIXJSVXLEX[[[,SWXRIXWPE [[2133,2631,2192,2670][8][,,][Arial]] 8E\IWERH6IKYPEXSV]*IIW%QSYRXWHYIYRHIV[LMGL70%MWMRGSVTSVEXIHMRXSXLMW%KVIIQIRXF]XLMW XLMW%KVIIQIRXEVII\GPYWMZISJEPPETTPMGEFPIJIHIVEPVIJIVIRGI%R]EQIRHQIRXWXSXLI70%WLEPPFIIJJIGXMZI WXEXIERHPSGEPWEPIWYWII\GMWIGSQQYRMGEXMSRWIVZMGIYTSRTSWXMRKEX,SWXcWWMXISRXLI;SVPH;MHI;IF SVWMQMPEVJIIWWYVGLEVKIWSVXE\IWERHER]SXLIVXE\IW)\GITXEWSXLIV[MWITVSZMHIHMRER]%HHIRHYQXLI70% CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 197 of 804 WIXWJSVXL'YWXSQIVcWWSPIERHI\GPYWMZIVIQIHMIWJSV;-00&)92-28)66948)()6636*6))36 ER]GPEMQVIPEXMRKXSXLI7IVZMGIWSV,SWXcWRIX[SVO'3140)8)0=7)'96) MRGPYHMRKER]JEMPYVIXSQIIXER]WIVZMGIPIZIPWEWWIX JSVXLMRXLI70%7IVZMGIWQE]MRGPYHIXLIEFMPMX]XS0MQMXEXMSRERH)\GPYWMSRSJ0MEFMPMX],378 XVERWQMXHEXEFI]SRH,SWXcWRIX[SVOXLVSYKLSXLIV7,%00238&)0-%&0)83'97831)636%2= RIX[SVOWTYFPMGERHTVMZEXI'YWXSQIVYRHIVWXERHW38,)64)673236)28-8=*36%2=-2(-6)'8 XLEX,SWXHSIWRSXS[RSVGSRXVSPSXLIVRIX[SVOW-2'-()28%074)'-%0492-8-:)36 SYXWMHISJ,SWXcWRIX[SVOERH,SWXMWRSXVIWTSRWMFPI'327)59)28-%0(%1%+)78,%8%6-7)3983* SVPMEFPIJSVTIVJSVQERGI SVRSRTIVJSVQERGI SJXLSWI366)0%8)838,-7%+6))1)28368,) RIX[SVOWSVXLIMRXIVGSRRIGXMSRTSMRXWFIX[IIRXLI7)6:-')7360-')27)7463:-()(,)6)92()6 7IVZMGIERHSXLIVRIX[SVOWXLEXEVISTIVEXIHF]XLMVH*36%2=6)%732;,%873):)66)+%6(0)77 TEVXMIW3*8,)'0%-136'%97)3*%'8-32-2'09(-2+ ;-8,3980-1-8%8-32&6)%',3*'3286%'8 -RXIPPIGXYEP4VSTIVX]4SPMG],SWXVIWTIGXWXLI&6)%',3*;%66%28=2)+0-+)2')786-'8 MRXIPPIGXYEPTVSTIVX]VMKLXWSJSXLIVWERHI\TIGXW0-%&-0-8=3638,)6;-7)8,)6)1)(-)77)8 'YWXSQIVWXSHSXLIWEQI,SWXVIWIVZIWXLIVMKLXEXMXW*368,-28,)70%7,%00&)'97831)6c7730) HMWGVIXMSRXSWYWTIRHSVXIVQMREXIXLI0MGIRWISJ%2()<'097-:)6)1)(-)7*36%2='0%-17 ERHSVHMWEFPIWLYXHS[RSVXIVQMREXIXLI7IVZMGIWSV6)0%8-2+838,)7)6:-')736,378c7 RIX[SVOGSRRIGXMSRXSWYGL7IVZMGIWSJYWIVW[LS2)8;36/)EGL'YWXSQIVVITVIWIRXEXMZIERHER]SXLIV MRJVMRKIXLIGST]VMKLXWXVEHIQEVOWSVSXLIVMRXIPPIGXYEPTIVWSRWZMWMXMRKE*EGMPMX]HSIWWSEXLMWSVLIVS[RVMWOERH TVSTIVX]VMKLXWSJSXLIVW,SWXWLEPPRSXFIPMEFPIJSVER]LEVQXSWYGLTIVWSRW VIWYPXMRKJVSQER]GEYWISXLIVXLER,SWX WKVSWWRIKPMKIRGI -4%HHVIWWIW,SWX[MPPQEMRXEMRI\GPYWMZISV[MPPJYPQMWGSRHYGXVIWYPXMRKMRTIVWSREPMRNYV]XSWYGL S[RIVWLMTERHGSRXVSPSJEPP-RXIVRIX4VSXSGSP d-4e TIVWSRWHYVMRKWYGLEZMWMX%HHMXMSREPP]MRRSIZIRX[MPP RYQFIVWERHEHHVIWWIW d-4%HHVIWWIWe XLEX,SWXQE],SWXFIPMEFPIXS'YWXSQIVSVER]SXLIVTIVWSRSVIRXMX]JSV EWWMKRXS'YWXSQIV,SWXQE]MRMXWWSPIHMWGVIXMSRER]GPEMQWEVMWMRKSYXSJSVVIPEXIHXS'YWXSQIVcWFYWMRIWW GLERKISVVIQSZIER]ERHEPP-4%HHVIWWIWEXER]XMQI'YWXSQIVcWGYWXSQIVWSVGPMIRXWSVJSVER]PSWXVIZIRYI %R]-4%HHVIWWIWEWWMKRIHXS'YWXSQIVF],SWXMRPSWXTVSJMXWVITPEGIQIRXKSSHWPSWWSJXIGLRSPSK]VMKLXWSV GSRRIGXMSR[MXLXLI7IVZMGIWSV0MGIRWIWWLEPPFIYWIHWIVZMGIWPSWWSJHEXESVMRXIVVYTXMSRSVPSWWSJYWISJE SRP]MRGSRRIGXMSR[MXLXLI7IVZMGIWSV0MGIRWIW-RXLI*EGMPMX]7IVZMGISV'YWXSQIVcWFYWMRIWWIZIRMJEHZMWIHSJ IZIRX'YWXSQIVHMWGSRXMRYIWYWISJXLI7IVZMGIWSVXLITSWWMFMPMX]SJWYGLHEQEKIW[LIXLIVYRHIVXLISV]SJ 0MGIRWIWJSVER]VIEWSRSVXLMW%KVIIQIRXXIVQMREXIWGSRXVEGXXSVX MRGPYHMRKRIKPMKIRGI WXVMGXPMEFMPMX]SV JSVER]VIEWSR'YWXSQIVcWVMKLXXSYWIXLI-4%HHVIWWIWSXLIV[MWI2SX[MXLWXERHMRKER]XLMRKXSXLIGSRXVEV]MRXLMW EWWSGMEXIH[MXLWYGL7IVZMGIWSV0MGIRWIWWLEPPEPWS%KVIIQIRXXLI70%SVER]SXLIVEKVIIQIRXFIX[IIRXLI XIVQMREXI,SWXVIWIVZIWXLIVMKLXXSGLERKIXLI-4TEVXMIW,SWX WQE\MQYQEKKVIKEXIPMEFMPMX]XS'YWXSQIV %HHVIWWIWEWWMKRIHXS'YWXSQIVVIPEXIHXSSVMRGSRRIGXMSR[MXLXLMW%KVIIQIRXXLI 0MGIRWIWERHXLI7IVZMGIWWLEPPFIPMQMXIHXSXLIXSXEP (MWGPEMQIH;EVVERXMIW)<')48*36EQSYRXTEMHF]'YWXSQIVXS,SWXYRHIVXLMW%KVIIQIRXJSV ,378c73&0-+%8-32792()6%2(79&.)'8XLIX[IPZI  QSRXLTIVMSHTVMSVXSXLIIZIRXSVIZIRXW 838,)70%%007)6:-')7%2(0-')27)7KMZMRKVMWIXSWYGLPMEFMPMX]2IMXLIV,SWXRSVER]SJMXW 463:-()(&=,37892()68,-7%+6))1)28XLMVHTEVX]ZIRHSVWWLEPPFIPMEFPIJSVER]XIQTSVEV]HIPE] %6)463:-()(d%7-7e%2(;-8,398%2=SYXEKIWSVMRXIVVYTXMSRWSJ'YWXSQIVcWYWISJXLI7IVZMGIW 6)46)7)28%8-3236;%66%28=3*%2=SVXLI*EGMPMX] /-2(-2'09(-2+;-8,3980-1-8%8-32 ;%66%28=%+%-278*%-096)3*-RHIQRMJMGEXMSR'YWXSQIVEKVIIWXSHIJIRH,SWX 4)6*361%2')-2'09(-2+%2=*%-096)MXWHMVIGXSVWSJJMGIVWIQTPS]IIWEJJMPMEXIWEKIRXWERH &)'%97)3*'31498)6,%6(;%6)36GYWXSQIVW GSPPIGXMZIP]d,SWX4EVXMIWe JVSQERHEKEMRWX '31192-'%8-327=78)17,378(3)7238 HIQERHMRZIWXMKEXMSRGPEMQEGXMSRWYMXTVSWIGYXMSR 1%/)%2((-7'0%-17%2('97831)6 SVSXLIVTVSGIIHMRKFVSYKLXF]ER]XLMVHTEVX] MRGPYHMRK ,)6)&=;%-:)7%006)0-%2')32%2= [MXLSYXPMQMXEXMSRER]KSZIVRQIRXEPSVUYEWMKSZIVRQIRXEP 6)46)7)28%8-32736;%66%28-)7%6-7-2+ EYXLSVMX] EKEMRWXER],SWX4EVX][LMGLMWHMVIGXP]SV &=0%;3638,)6;-7)6)+%6(-2+8,) MRHMVIGXP]FEWIHYTSRVIPEXIHXSSVEPPIKIWMR[LSPISVTEVX 7)6:-')7%2(0-')27)7-2'09(-2+-140-)( E EZMSPEXMSRF]'YWXSQIVER]VIWIPPIVSVIRHYWIV ;%66%28-)73*1)6',%28%&-0-8=*-82)77 SFXEMRMRK7IVZMGIWHMVIGXP]SVMRHMVIGXP]JVSQ'YWXSQIVSV *36%4%68-'90%6496437)232 ER]EJJMPMEXIEKIRXSVIQTPS]IISJER]SJXLIJSVIKSMRK -2*6-2+)1)2836%6-7-2+*631'3967)3* GSPPIGXMZIP]d'YWXSQIV4EVXMIWe SJER]PE[VIKYPEXMSR ()%0-2+'3967)3*4)6*361%2')36 WXEXYXIVYPISVHMRERGIXEVMJJXVIEX]KYMHIPMRIWXERHEVH 97%+)-286%(),378(3)7238;%66%28 GSRZIRXMSRSVHIVEKVIIQIRXGSRXVEGXSVMRWXVYQIRX F E 8,%8'97831)6c797)3*8,)7)6:-')7 FVIEGLF]'YWXSQIVSJER]VITVIWIRXEXMSR[EVVERX]SV ,378c72)8;36/%2(36,378c7*%'-0-8= GSZIRERXWIXJSVXLMRXLMW%KVIIQIRX G XLIKVSWW RIKPMKIRGISV[MPPJYPQMWGSRHYGXSJER]'YWXSQIV4EVX] CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 198 of 804 H MRJVMRKIQIRXSVQMWETTVSTVMEXMSRSJER]MRXIPPIGXYEPVIGIMTXVIUYIWXIHTSWXEKITVITEMH-RXLIGEWISJRSXMGIXS TVSTIVX]VMKLXWHIJEQEXMSRPMFIPWPERHIVSFWGIRMX],SWXXS&VSEHFERH3RI00'&SGE6EXSR&SYPIZEVH TSVRSKVETL]SVZMSPEXMSRSJXLIVMKLXWSJTVMZEG]SV2;7YMXI&SGE6EXSR*PSVMHE%XXIRXMSR TYFPMGMX]WTEQQMRKSVER]SXLIVSJJIRWMZISVLEVEWWMRK.IJJVI]%(EZMW')3[MXLEGST]XS8SFMR 4% GSRHYGXF]ER]'YWXSQIV4EVX]SV I XLIEGXWSV2)1M^RIV&SYPIZEVH7YMXI&SGE6EXSR*PSVMHE SQMWWMSRWSJER]'YWXSQIV4EVX]VIPEXIHXSER]7IVZMGI%XXIRXMSR(EZMH78SFMR)WUERHMJXS'YWXSQIV SV0MGIRWITVSZMHIHLIVIYRHIV GSPPIGXMZIP]d'PEMQWe XSXLIQSWXVIGIRXEHHVIWWSJ'YWXSQIVMR,SWXcWVIGSVHW 'YWXSQIVWLEPPMRHIQRMJ]ERHLSPHLEVQPIWW,SWXJSV-RXLIGEWISJRSXMGIF]IPIGXVSRMGQEMPXS,SWXXS ER]NYHKQIRXWWIXXPIQIRXWJMRIWJIIWWERGXMSRWRSXMGIW$LSWXRIX)MXLIVTEVX]QE]GLERKIMXWEHHVIWWJSV TIREPXMIWPSWWIWHEQEKIWI\TIRWIWERHGSWXWRSXMGITYVTSWIWF]TVSZMHMRK[VMXXIRRSXMGISJWYGLGLERKI MRGPYHMRK[MXLSYXPMQMXEXMSRVIEWSREFPIEXXSVRI]WcXSXLISXLIVTEVX]MREGGSVHERGI[MXLXLMW7IGXMSR%R] JIIW VIWYPXMRKJVSQSVMRGSRRIGXMSR[MXLER]WYGLRSXMGITVSZMHIHTYVWYERXXSXLMW7IGXMSR[MPPFIHIIQIHXS 'PEMQSVXLIHIJIRWIXLIVISJERHER]HEQEKISVLEZIFIIRKMZIREWSJXLIHEXIMXMWHIPMZIVIH HIWXVYGXMSRXSXLI*EGMPMX]RIX[SVOTVIQMWIWSV IUYMTQIRXSJER],SWX4EVX]VIWYPXMRKMR[LSPISVTEVX F *SVGI1ENIYVI)\GITXJSVXLISFPMKEXMSRXS JVSQXLIEGXWSVSQMWWMSRWER]'YWXSQIV4EVX]-RRSTE]QSRI]RIMXLIVTEVX][MPPFIPMEFPIJSVER]JEMPYVISV IZIRXWLEPP'YWXSQIVWIXXPISVGSRWIRXXSER]NYHKQIRXHIPE]MRMXWTIVJSVQERGIYRHIVXLMW%KVIIQIRXHYIXSER] TIVXEMRMRKXSER]WYGLEGXMSR[MXLSYXXLITVMSV[VMXXIRGEYWIFI]SRHMXWVIEWSREFPIGSRXVSPMRGPYHMRK[MXLSYX GSRWIRXSJ,SWXPMQMXEXMSRXLIEGXWSVSQMWWMSRWSJYRHIVP]MRKXLMVHTEVX] WYTTPMIVWEGXWSJ[EVEGXWSJ+SHIEVXLUYEOIJPSSH 'SRJMHIRXMEP-RJSVQEXMSR)EGLTEVX]IQFEVKSVMSXWEFSXEKIPEFSVWLSVXEKISVHMWTYXI EGORS[PIHKIWXLEXMX[MPPLEZIEGGIWWXSGIVXEMRKSZIVRQIRXEPEGXSVJEMPYVISJXLI-RXIVRIXERHWYGLSXLIV GSRJMHIRXMEPMRJSVQEXMSRSJXLISXLIVTEVX]GSRGIVRMRKGEYWIWEWQE]FIWXEXIHMRXLI70%TVSZMHIHXLEXXLI XLISXLIVTEVX] WFYWMRIWWTPERWGYWXSQIVWXIGLRSPSK]HIPE]IHTEVX] M KMZIWXLISXLIVTEVX]TVSQTXRSXMGISJ ERHTVSHYGXWMRGPYHMRKXLIXIVQWERHGSRHMXMSRWSJXLMWWYGLGEYWIERH MM YWIWMXWVIEWSREFPIGSQQIVGMEPIJJSVXW %KVIIQIRX d'SRJMHIRXMEP-RJSVQEXMSRe )EGLTEVX]XSGSVVIGXTVSQTXP]WYGLJEMPYVISVHIPE]MRTIVJSVQERGI EKVIIW EWEd6IGMTMIRXe XLEXMX[MPPRSXYWIMRER][E] JSVMXWS[REGGSYRXSVXLIEGGSYRXSJER]XLMVHTEVX] G 1EVOIXMRK'YWXSQIVEKVIIWXLEX,SWXQE] I\GITXEWI\TVIWWP]TIVQMXXIHF]XLMW%KVIIQIRXRSVVIJIVXS'YWXSQIVF]XVEHIREQIERHXVEHIQEVOERHQE] HMWGPSWIXSER]XLMVHTEVX] I\GITXXS6IGMTMIRXcWFVMIJP]HIWGVMFI'YWXSQIVcWFYWMRIWWMR,SWX WQEVOIXMRK EXXSVRI]WEGGSYRXERXWERHSXLIVEHZMWSVWEWVIEWSREFP]QEXIVMEPWERH[IFWMXI'YWXSQIVLIVIF]KVERXW,SWXE RIGIWWEV] ER]'SRJMHIRXMEP-RJSVQEXMSRSJXLISXLIVPMQMXIHPMGIRWIXSYWIER]'YWXSQIVXVEHIREQIWERH TEVX] d(MWGPSWIVe ERH[MPPXEOIVIEWSREFPITVIGEYXMSRWXVEHIQEVOWWSPIP]MRGSRRIGXMSR[MXLXLIVMKLXWKVERXIHXS XSTVSXIGXXLIGSRJMHIRXMEPMX]SJWYGL'SRJMHIRXMEP,SWXTYVWYERXXSXLMW7IGXMSR%PPKSSH[MPPEWWSGMEXIH[MXL -RJSVQEXMSR-RJSVQEXMSRXLEX6IGMTMIRXGERIWXEFPMWL'YWXSQIVcWXVEHIREQIERHXVEHIQEVOW[MPPMRYVIWSPIP]XS E [EWPE[JYPP]MR6IGMTMIRX WTSWWIWWMSRFIJSVIVIGIMTX'YWXSQIV'YWXSQIVQE]HMWTPE]XLI,SWXPSKSSVER] JVSQ(MWGPSWIVERHMW[MXLSYXVIWXVMGXMSREWXSYWISVSXLIV,SWXXVEHIQEVOSVWIVZMGIQEVOSVPSKSSR HMWGPSWYVISV F MWSVFIGSQIWEQEXXIVSJTYFPMG'YWXSQIVcW[IFWMXIWSVQEVOIXMRKPMXIVEXYVISRP]EJXIV ORS[PIHKIXLVSYKLRSJEYPXSJ6IGMTMIRXSV G [EWSFXEMRMRK,SWXcW[VMXXIRETTVSZEPSREGEWIF]GEWIFEWMW MRHITIRHIRXP]HIZIPSTIHSVHMWGSZIVIHF]6IGMTMIRXERHTVSZMHIHXLEX'YWXSQIVEFMHIWF]XLI,SWXXVEHIQEVO [MXLSYXVIJIVIRGIXSSVYWISJER]SJXLI'SRJMHIRXMEPKYMHIPMRIWERHWYGLSXLIVKYMHIPMRIWEW,SWXQE]TVSZMHI -RJSVQEXMSRSJXLI(MWGPSWIVSV H MWVMKLXJYPP]'YWXSQIV%PPKSSH[MPPEWWSGMEXIH[MXL,SWXcWXVEHIREQI EGUYMVIHF]6IGMTMIRXJVSQEXLMVHTEVX][LSLEWXLIXVEHIQEVOWWPSKERWERHPSKSW[MPPMRYVIWSPIP]XS,SWX VMKLXXSHMWGPSWIMXERH[LSTVSZMHIWMX[MXLSYX VIWXVMGXMSREWXSYWISVHMWGPSWYVIWLEPPRSXFI H +SZIVRQIRX6IKYPEXMSRW'YWXSQIV[MPPRSX GSRWMHIVIH'SRJMHIRXMEP-RJSVQEXMSR2SX[MXLWXERHMRKI\TSVXVII\TSVXXVERWJIVSVQEOIEZEMPEFPI[LIXLIV XLIJSVIKSMRK6IGMTMIRXQE]HMWGPSWI'SRJMHIRXMEPHMVIGXP]SVMRHMVIGXP]ER]VIKYPEXIHMXIQSVMRJSVQEXMSRXS -RJSVQEXMSRSJ(MWGPSWIVMJERHXSXLII\XIRXMXMWER]SRISYXWMHIXLI97MRGSRRIGXMSR[MXLXLMW%KVIIQIRX VIUYMVIHXSHSWSF]PE[ SRXLIEHZMGISJGSYRWIP [MXLSYXJMVWXGSQTP]MRK[MXLEPPI\TSVXGSRXVSPPE[WERH TVSZMHIHXLEX6IGMTMIRXWLEPPYWIGSQQIVGMEPP]VIKYPEXMSRW[LMGLQE]FIMQTSWIHF]XLI97+SZIVRQIRX VIEWSREFPIIJJSVXWXSKMZIXLI(MWGPSWIVWYJJMGMIRXRSXMGIERHER]GSYRXV]SVSVKERM^EXMSRSJREXMSRW[MXLMR[LSWI XSIREFPIMXXSWIIOERSVHIVPMQMXMRKSVTVIGPYHMRKWYGLNYVMWHMGXMSR'YWXSQIVSTIVEXIWSVHSIWFYWMRIWW'YWXSQIV HMWGPSWYVI EX(MWGPSWIVcWI\TIRWI VITVIWIRXWERH[EVVERXWXLEX'YWXSQIV M MWRSXPSGEXIHMRE GSYRXV]WYFNIGXXS9RMXIH7XEXIWIQFEVKSIWSVPMWXIHSRXLI 1MWGIPPERISYW9RMXIH7XEXIW8VIEWYV](ITEVXQIRXcWPMWXSJWTIGMEPP] HIWMKREXIHREXMSREPWSVPMWXIHSRXLI9RMXIH7XEXIW E 2SXMGIW%R]RSXMGISVGSQQYRMGEXMSR'SQQIVGI(ITEVXQIRXcWHIRMIHTIVWSRWPMWXSVIRXMXMIWPMWX VIUYMVIHSVTIVQMXXIHXSFIKMZIRLIVIYRHIVQE]FIERH MM MJERMRHMZMHYEPMWEXPIEWX]IEVWSJEKI HIPMZIVIHTIVWSREPP]HITSWMXIH[MXLERSZIVRMKLX GSYVMIVWIRXF]GSRJMVQIHJEGWMQMPIIPIGXVSRMGQEMPSV I %WWMKRQIRX,SWXVIWIVZIWXLIVMKLXERH VIKYPEVQEMPIHF]VIKMWXIVIHSVGIVXMJMIHQEMPVIXYVR'YWXSQIVKVERXWXLIVMKLXJSV,SWXXSEWWMKRXLMW%KVIIQIRX CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 199 of 804 'YWXSQIVQE]RSXEWWMKRER]SJMXWVMKLXWLIVIMRSVXLITEVXMIWMRXLIEHQMRMWXVEXMSRSJXLIXIVQWSJXLMW HIPIKEXIMXWHYXMIWYRHIVXLMW%KVIIQIRXIMXLIVMR[LSPI%KVIIQIRXFIGSRWXVYIHXS[EMZISVPIWWIRXLIVMKLXSJWYGL SVMRTEVX[MXLSYXXLITVMSV[VMXXIRGSRWIRXSJ,SWXMRTEVX]XSMRWMWXYTSRXLITIVJSVQERGIF]XLISXLIVTEVX]MR IEGLMRWXERGI%R]EXXIQTXIHEWWMKRQIRXSVHIPIKEXMSRWXVMGXEGGSVHERGI[MXLXLIXIVQWSJXLMW%KVIIQIRX [MXLSYXGSQTPMERGI[MXLXLMW7IGXMSR[MPPFIZSMH8LMW %KVIIQIRX[MPPFMRHERHMRYVIXSXLIFIRIJMXSJIEGL M ,IEHMRKW8LIREQISJXLMW%KVIIQIRXERH TEVX] WWYGGIWWSVWERHTIVQMXXIHEWWMKRW)EGLVIUYIWXXLILIEHMRKWSJXLI7IGXMSRWLIVISJEVIJSVGSRZIRMIRGISJ F]'YWXSQIVJSVETVSTSWIHEWWMKRQIRXWLEPPFIVIJIVIRGISRP]ERHWLEPPMRRS[E]EJJIGXXLIGSRWXVYGXMSR EGGSQTERMIHF]ERSRVIJYRHEFPIJIITE]EFPIXS,SWXMRSJSVFIXEOIRMRXSGSRWMHIVEXMSRMRMRXIVTVIXMRKXLMW XLIEQSYRXSJ7IZIR,YRHVIH*MJX](SPPEVW  XS%KVIIQIRX GSZIV,SWXcWEHQMRMWXVEXMZIPIKEPERHSXLIVGSWXWERH I\TIRWIWMRGYVVIHMRTVSGIWWMRKIEGLSJ'YWXSQIVcW N )RXMVI%KVIIQIRX8LMW%KVIIQIRXMRGPYHMRK VIUYIWXWXLIGSZIVTEKII\IGYXIHF]XLITEVXMIWXLIWI8IVQWERH 'SRHMXMSRWXLIETTPMGEFPI%HHIRHE7IVZMGI3VHIVW%94 J 6IPEXMSRWLMTSJ4EVXMIW,SWXERHERH70%VITVIWIRXXLIGSQTPIXIEKVIIQIRXERH 'YWXSQIVEVIMRHITIRHIRXGSRXVEGXSVWERHXLMWYRHIVWXERHMRKSJXLITEVXMIW[MXLVIWTIGXXSXLIWYFNIGX %KVIIQIRX[MPPRSXIWXEFPMWLER]VIPEXMSRWLMTSJQEXXIVLIVIMRERHWYTIVWIHIEPPTVIZMSYWERH TEVXRIVWLMTNSMRXZIRXYVIIQTPS]QIRXJVERGLMWISVGSRXIQTSVERISYWEKVIIQIRXWVITVIWIRXEXMSRWSV EKIRG]FIX[IIR,SWXERH'YWXSQIV2IMXLIV,SWXRSVYRHIVWXERHMRKW[VMXXIRSVSVEPVIPEXIHXSXLIWYFNIGXQEXXIV 'YWXSQIV[MPPLEZIXLITS[IVXSFMRHXLISXLIVSVMRGYVLIVIMRERHWLEPPTVIZEMPRSX[MXLWXERHMRKER]ZEVMERGI[MXL SFPMKEXMSRWSRXLISXLIVcWFILEPJ[MXLSYXXLISXLIVcWXIVQWERHGSRHMXMSRWSJER]SVHIVWYFQMXXIH8LMW TVMSV[VMXXIRGSRWIRXI\GITXEWSXLIV[MWII\TVIWWP]%KVIIQIRXQE]FIQSHMJMIHSRP]XLVSYKLE[VMXXIR TVSZMHIHLIVIMR8LMW%KVIIQIRXMWRSXMRXIRHIHXSMRWXVYQIRXWMKRIHF]FSXLTEVXMIW&SXLTEVXMIWVITVIWIRX GSRJIVYTSRER]SXLIVTIVWSRSVIRXMX]ER]VMKLXWSVERH[EVVERXXLEXXLI]LEZIJYPPGSVTSVEXITS[IVERH VIQIHMIWLIVIYRHIVEYXLSVMX]XSI\IGYXIERHHIPMZIVXLMW%KVIIQIRXERHXS TIVJSVQXLIMVSFPMKEXMSRWYRHIVXLMW%KVIIQIRXERHXLEXXLI K 'LSMGISJ0E[ERH%XXSVRI]Wc*IIW8LMWTIVWSR[LSWIWMKREXYVIETTIEVWFIPS[MWHYP]EYXLSVM^IHXS %KVIIQIRXWLEPPFIKSZIVRIHF]ERHGSRWXVYIHMRIRXIVMRXSXLMW%KVIIQIRXSRFILEPJSJXLIVIWTIGXMZITEVX] EGGSVHERGI[MXLXLIPE[WSJXLI7XEXISJ*PSVMHE[MXLSYX7LSYPHER]XIVQWSJXLMW%KVIIQIRXFIHIGPEVIHZSMHSV KMZMRKIJJIGXXSTVMRGMTPIWSJGSRJPMGXSJPE[W8LIYRIRJSVGIEFPIF]ER]EVFMXVEXSVSVGSYVXSJGSQTIXIRX TEVXMIWMVVIZSGEFP]ERHYRGSRHMXMSREPP]WYFQMXXSXLINYVMWHMGXMSRWYGLXIVQW[MPPFIEQIRHIHXSEGLMIZIEW I\GPYWMZINYVMWHMGXMSRSJXLIGSYVXWSJXLI7XEXISJ*PSVMHERIEVP]EWTSWWMFPIXLIWEQIIGSRSQMGIJJIGXEWXLISVMKMREP PSGEXIHMR4EPQ&IEGL'SYRX]SVMRXLI9RMXIH7XEXIWXIVQWERHXLIVIQEMRHIVSJXLMW%KVIIQIRX[MPPVIQEMRMR (MWXVMGX'SYVXJSVXLI7SYXLIVR(MWXVMGXSJ*PSVMHEJSVXLIJYPPJSVGIERHIJJIGX'YWXSQIV WVIGSVHEXMSRSJXLMW TYVTSWIWSJER]WYMXEGXMSRSVSXLIVTVSGIIHMRKEVMWMRKSYX%KVIIQIRXSVER]QIQSVERHYQSVWLSVXJSVQSJMX[MPPFI SJXLMW%KVIIQIRXSVXLIWYFNIGXQEXXIVLIVISJFVSYKLXF]ZSMHERHGSRWXMXYXIEHIJEYPXYRHIVXLMW%KVIIQIRX ER]TEVX]LIVIXSERHLIVIF][EMZIERHEKVIIRSXXSEWWIVX EWEHIJIRWISVSXLIV[MWIMRER]WYGLWYMXEGXMSRSV O 0EGOSJ4VIWYQTXMSR%KEMRWX(VEJXWQER TVSGIIHMRKER]GPEMQXLEXMXMWRSXWYFNIGXTIVWSREPP]XS)EGLSJXLITEVXMIWLIVIXSEGORS[PIHKIWERHEKVIIWXLEXXLMW XLINYVMWHMGXMSRSJXLIEFSZIREQIHGSYVXWXLEXMXW%KVIIQIRXLEWFIIRHMPMKIRXP]VIZMI[IHERHRIKSXMEXIHF] TVSTIVX]MWI\IQTXSVMQQYRIJVSQEXXEGLQIRXSVERHEQSRKXLIQXLEXMRWYGLRIKSXMEXMSRWIEGLSJXLIQLEW I\IGYXMSRXLEXXLIWYMXEGXMSRSVTVSGIIHMRKMWFVSYKLXMRFIIRVITVIWIRXIHF]GSQTIXIRXGSYRWIPERHXLEXXLIJMREP ERMRGSRZIRMIRXJSVYQXLEXXLIZIRYISJXLIWYMXEGXMSRSVEKVIIQIRXGSRXEMRIHLIVIMRMRGPYHMRKXLIPERKYEKI TVSGIIHMRKMWMQTVSTIVSVXLEXXLMW%KVIIQIRXSVXLI[LIVIF]MXLEWFIIRI\TVIWWIHVITVIWIRXWXLINSMRXIJJSVXW WYFNIGXQEXXIVLIVISJQE]RSXFIIRJSVGIHF]WYGLGSYVXSJXLITEVXMIWLIVIXSERHXLIMVGSYRWIPWEGGSVHMRKP]MR 'YWXSQIVEGORS[PIHKIWERHEKVIIWXLEXMXMWVIEWSREFPIXSMRXIVTVIXMRKXLMW%KVIIQIRXSVER]TVSZMWMSRLIVISJRS I\TIGXXLEXMXGSYPHFIVIUYMVIHXSHIJIRHMXWIPJMRXLIWXEXITVIWYQTXMSRWLEPPETTP]EKEMRWXER]TEVX]LIVIXSEWFIMRK ERHSVJIHIVEPGSYVXWPSGEXIHMRXLI7XEXISJ*PSVMHE4EPQVIWTSRWMFPIJSVXLI[SVHMRKSVHVEJXMRKSJXLMW%KVIIQIRXSV &IEGL'SYRX]-JER]PIKEPEGXMSRMWFVSYKLXF]IMXLIVWYGLTVSZMWMSR TEVX]XSIRJSVGIMXWVMKLXWYRHIVXLMW%KVIIQIRXXLI RSRTVIZEMPMRKTEVX]MRWYGLEGXMSRWLEPPVIMQFYVWIXLI P 7YVZMZEP%PPSJXLITVSZMWMSRWSJXLMW TVIZEMPMRKTEVX]EPPSJWYGLTVIZEMPMRKTEVX]cWGSWXWERH%KVIIQIRX[LMGLF]XLIMVXIVQWSVREXYVIEVIMRXIRHIHXS I\TIRWIW MRGPYHMRKVIEWSREFPIEXXSVRI]WcJIIWERHWYVZMZIXLIXIVQMREXMSRSVI\TMVEXMSRSJXLMW%KVIIQIRX I\TIRWIW MRGYVVIHMRGSRRIGXMSR[MXLWYGLEGXMSRMRGPYHMRK[MXLSYXPMQMXEXMSR7IGXMSRW  G  J  K  O  P ERHXLI%HHIRHE L ;EMZIV8LI[EMZIVF]IMXLIVTEVX]SJERH7IVZMGI3VHIVWWLEPPWYVZMZIXLIXIVQMREXMSRSV ER]XIVQGSRHMXMSRSVTVSZMWMSRGSRXEMRIHMRXLMWI\TMVEXMSRSJXLMW%KVIIQIRX %KVIIQIRX[MPPRSXFIHIIQIHXSFIE[EMZIVSJER] WYFWIUYIRXFVIEGLSJXLIWEQISVER]SXLIVXIVQ GSRHMXMSRSVTVSZMWMSRGSRXEMRIHMRXLMW%KVIIQIRXRSV [MPPER]GYWXSQSVTVEGXMGIXLEXQE]KVS[YTFIX[IIR CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 200 of 804 Z '303'%8-320-')27)%(()2(91 XS1EWXIV7IVZMGIW%KVIIQIRX 8LMW'SPSGEXMSR0MGIRWI%HHIRHYQ XLMWd%HHIRHYQe XS1EWXIV7IVZMGIW%KVIIQIRXHIWGVMFIWEHHMXMSREPXIVQWERH GSRHMXMSRWVIPEXIHXS,SWXcWKVERXSJE'SPSGEXMSR0MGIRWIXS'YWXSQIV%PPGETMXEPM^IHXIVQWYWIHFYXRSXSXLIV[MWIHIJMRIHMRXLMW %HHIRHYQWLEPPLEZIXLIQIERMRKWEWGVMFIHXSXLIQMRXLI8IVQWERH'SRHMXMSRW[LMGLJSVQETEVXSJXLI1EWXIV7IVZMGIW %KVIIQIRX +6%283*'303'%8-320-')27)-R7)6:-')77)894()0-:)6=%2( GSRWMHIVEXMSRSJXLITE]QIRXF]'YWXSQIVSJEPPETTPMGEFPI-278%00%8-323*)59-41)28 *IIWERHWYFNIGXXSEPPSJXLIXIVQWERHGSRHMXMSRWSJXLI %KVIIQIRX,SWXLIVIF]KVERXWXS'YWXSQIVHYVMRKXLI E 7ITEVEXI%HHIRHYQ6IUYMVIHJSV7IVZMGIW 0MGIRWI8IVQ EWLIVIEJXIVHIJMRIH EPMQMXIHRSRI\GPYWMZI'YWXSQIVEGORS[PIHKIWXLEX7IVZMGIWEVIRSXMRGPYHIHMRXLI PMGIRWI XLId'SPSGEXMSR0MGIRWIe  E XSMRWXEPPSTIVEXIERH'SPSGEXMSR0MGIRWIERHQE]SRP]FISFXEMRIHTYVWYERXXSE QEMRXEMRGSQQYRMGEXMSRWERHSV-8IUYMTQIRX XLIJYPP]I\IGYXIH7IVZMGI%HHIRHYQVIPEXIHXSWYGL7IVZMGIWEW d)UYMTQIRXe MRXLITSVXMSRSJ,SWXcW*EGMPMX]HIWGVMFIHMRXLIHIWGVMFIHSRXLI'SZIV4EKIXSXLI%KVIIQIRX-RXLIIZIRX ETTPMGEFPI7IVZMGI3VHIVMRGPYHMRKEPPVEGOWGEFMRIXWERHSV7IVZMGI3VHIVWE'SPSGEXMSR0MGIRWIERH7IVZMGIWSRXLIWEQI GEKIWJSVQMRKETEVXXLIVISJ XLId0MGIRWIH%VIEe WSPIP]JSV7IVZMGI3VHIVXLITVSZMWMSRWSJXLI7IVZMGI3VHIVVIPEXIHXS XLITYVTSWISJWYTTSVXMRKPSGEPEGGIWWGSQQYRMGEXMSRW7IVZMGIWWLEPPRSXFIIJJIGXMZIYRPIWWERHYRXMPXLITEVXMIWLEZI JEGMPMXMIWERHPMROWXS,SWXERHXSXLMVHTEVXMIWXLEXLEZIFIIRI\IGYXIHXLIETTPMGEFPI%HHIRHYQJSVWYGL7IVZMGIW2SXLMRK ETTVSZIHF],SWXMR[VMXMRKERH F XSYWIGSQQSREVIEWMRXLMWTEVEKVETLWLEPPFIGSRWXVYIHEWETTP]MRKXSXLIWIXYT [MXLMRXLI*EGMPMX]EWEQIERWSJMRKVIWWERHIKVIWWJSVKEMRMRKEGXMZMXMIWHIWGVMFIHFIPS[[LMGLEVIXSFITVSZMHIHF],SWXEW EGGIWWXSXLI0MGIRWIH%VIEERHXLI)UYMTQIRX7YFNIGXXSER]ETEVXSJXLI'SPSGEXMSR0MGIRWIMRI\GLERKIJSVXLIETTPMGEFPI YWEKIPMQMXEXMSRWWTIGMJMIHMRXLI7IVZMGI3VHIVSVSXLIV[MWI 7IXYT*IIWHIWGVMFIHMR7IGXMSRFIPS[ GSQQYRMGEXIHMR[VMXMRKXS'YWXSQIV,SWXWLEPPYWI GSQQIVGMEPP]VIEWSREFPIIJJSVXWXSWYTTP]XLI0MGIRWIH%VIE F 7IXYT%GXMZMXMIW,SWX[MPPFIKMRMRJVEWXVYGXYVI [MXLIPIGXVMGTS[IV YXMPMX][MXLKIRIVEXSVFEGOYT FYXWLEPPTS[IV[MVMRKERHSXLIVWIXYTEGXMZMXMIWHIWGVMFIHMRXLI RSXFIPMEFPIJSVER]PSWWHEQEKISVHMWVYTXMSRVIWYPXMRKJVSQ7IVZMGI3VHIVERHRSXMJ]'YWXSQIVSJXLIHEXIERHXMQISJXLI ER]TS[IVWYVKIMRXIVVYTXMSRSVJEMPYVI'YWXSQIV7GLIHYPIH-RWXEPPEXMSR(EXITVSQTXP]EJXIVEPPSJXLIJSPPS[MRK EGORS[PIHKIWXLEXXLI0MGIRWIH%VIEMWTVSZMHIHSRERd%7LEZISGGYVVIH M FSXLTEVXMIWLEZII\IGYXIHERHHIPMZIVIHXLI -7eFEWMWERHXLEXXLMW'SPSGEXMSR0MGIRWIHSIWRSXERHWLEPPETTPMGEFPI7IVZMGI3VHIVERHEPPSXLIVTEVXWSJXLI%KVIIQIRX RSXFIHIIQIHXSKVERXHIQMWIXVERWJIVPIEWISVSXLIV[MWI MRGPYHMRKEPPTEKIWSJXLMW%HHIRHYQERHXLI%HHIRHYQ GSRZI]XS'YWXSQIVER]VMKLXXMXPISVMRXIVIWX[LEXWSIZIVMRSVETTPMGEFPIXSIEGL7IVZMGIMJER]SVHIVIHF]'YWXSQIVJSVYWI XSER]TSVXMSRSJXLISZIVEPPTVSTIVX]MRGPYHMRKXLI0MGIRWIHMRGSRRIGXMSR[MXLXLI'SPSGEXMSR0MGIRWI [LMGLEVIXSFI %VIESVXLI*EGMPMX]SVXS,SWXcWPIEWILSPHMRXIVIWXXLIVIMRI\IGYXIHSVMRMXMEPIHERHHIPMZIVIHF]XLITEVXMIW MM  ,SWXLIVIF]VIWIVZIWEPPVMKLXWRSXWTIGMJMGEPP]KVERXIHXS'YWXSQIVLEWTEMHXS,SWXEPPSJXLI7IX9T*IIWHIWGVMFIH 'YWXSQIVMRGPYHMRK[MXLSYXPMQMXEXMSRXLIVMKLXXSEGGIWWERHFIPS[ MMM 'YWXSQIVLEWHIPMZIVIHXS,SWXXLIGIVXMJMGEXI W SJ YWIXLI*EGMPMX]JSVMXWS[RYWIERHJSVXLIYWISJMXWEKIRXWMRWYVERGIHIWGVMFIHFIPS[YRHIVXLIWIGXMSRGETXMSRIH VITVIWIRXEXMZIWERHPMGIRWIIW8LI'SPSGEXMSR0MGIRWIMWd-RWYVERGI6IUYMVIQIRXWeERH MZ 'YWXSQIVLEWTVSZMHIH I\TVIWWP]QEHIWYFNIGXERHWYFSVHMREXIXSXLIXIVQWERH,SWX[MXLEGSQTPIXIH'YWXSQIV%YXLSVM^IH'SRXEGX0MWX GSRHMXMSRWSJER]YRHIVP]MRKKVSYRHSVJEGMPMXMIWPIEWISVSXLIV WYTIVMSVVMKLXF][LMGL,SWXLEWEGUYMVIHMRXIVIWXMRXLI G 'YWXSQIV)UYMTQIRX'YWXSQIV[MPPXEOIEPP *EGMPMX]EGXMSRVIUYMVIHXSIRWYVIXLEXXLIRIGIWWEV])UYMTQIRXERH TIVWSRRIPSJ'YWXSQIVEVITVITEVIHMREHZERGIXSGSQTPIXIXLI 0-')27)8)61)\GITXEWSXLIV[MWITVSZMHIHMRWXEPPEXMSRMREGGSVHERGI[MXLEPPETTPMGEFPITSPMGMIW IPWI[LIVIMRXLI%KVIIQIRXXLIXIVQSJXLI'SPSGEXMSRTVSGIHYVIWERHMRWXVYGXMSRWTVSZMHIHF],SWX)\GITXEW 0MGIRWI d0MGIRWI8IVQe WLEPPGSQQIRGIYTSRXLIHEXI[LIRSXLIV[MWIWTIGMJMGEPP]TVSZMHIHMRER]7IVZMGI3VHIV XLI'YWXSQIVMWKVERXIHEGGIWWSVSRXLIHEXIXLEXMWXLMVX]  'YWXSQIVWLEPPRSXWXSVISVQEMRXEMREXXLI0MGIRWIH%VIESV HE]WEJXIVXLIHEXIXLEXXLI7IVZMGI3VHIVMWI\IGYXIHF],SWXIPWI[LIVIMRXLI*EGMPMX]ER]TVSTIVX]SVIUYMTQIRX ERH'YWXSQIV[LMGLIZIVSGGYVWJMVWX d7GLIHYPIH-RWXEPPEXMSR[LEXWSIZIV[MXLSYXXLITVMSV[VMXXIRGSRWIRXSJ,SWXMRIEGL (EXIe ERHYRPIWWVIRI[IHMREGGSVHERGI[MXLXLIVIQEMRMRKMRWXERGI [LMGLGSRWIRXWLEPPRSXFIYRVIEWSREFP][MXLLIPH TVSZMWMSRWSJXLMWTEVEKVETLI\TMVIEXXLIIRHSJXLIMRMXMEPGSRHMXMSRIHSVHIPE]IH 'YWXSQIVEYXLSVM^IW,SWXERH,SWX TIVMSHWTIGMJMIHMRXLIETTPMGEFPI7IVZMGI3VHIV XLId-RMXMEPEKVIIWXSEGGITXHIPMZIV]SJERHSVTVSZMHIWXSVEKI FEWIH 8IVQe %XXLII\TMVEXMSRSJXLI-RMXMEP8IVQERHIEGLYTSREZEMPEFMPMX] JSV'YWXSQIVcWETTVSZIH)UYMTQIRXEXXLI 6IRI[EP8IVQ EWLIVIEJXIVHIJMRIH MJER]XLI0MGIRWI8IVQ*EGMPMX]TVSZMHIHLS[IZIVXLEX'YWXSQIVEKVIIWXSEFMHIF] WLEPPEYXSQEXMGEPP]VIRI[JSVEREHHMXMSREPQSRXLTIVMSHSV,SWXcW)UYMTQIRX(IPMZIV]7XSVEKI4VSGIHYVIWEWEQIRHIH WYGLPSRKIVVIRI[EPXIVQEWQE]FIWTIGMJMIHMRXLIETTPMGEFPIJVSQXMQIXSXMQI'YWXSQIVLEWVIZMI[IHXLIGYVVIRXZIVWMSR 7IVZMGI3VHIV IEGLEd6IRI[EP8IVQe YRPIWWIMXLIVTEVX]SJWYGLTVSGIHYVIW%R]EQIRHQIRXWXLIVIXSWLEPPFI HIPMZIVW[VMXXIRRSXMGIXSXLISXLIVTEVX]EXPIEWXHE]WTVMSVIJJIGXMZIYTSRTSWXMRKMREGSRWTMGYSYWPSGEXMSREXXLI XSWYGLVIRI[EPMRHMGEXMRKMXWHIWMVIXSEPPS[XLI0MGIRWI*EGMPMX]'YWXSQIVLIVIF]VIPIEWIW,SWXJVSQER]ERHEPP 8IVQXSI\TMVIEXXLIWGLIHYPIHI\TMVEXMSRSJXLI-RMXMEP8IVQPMEFMPMX]JSVER]HMVIGXMRHMVIGXMRGMHIRXEPIGSRSQMGWTIGMEP SVER]6IRI[EP8IVQXLIRMRIJJIGXTYRMXMZISVGSRWIUYIRXMEPHEQEKIWEVMWMRKJVSQ,SWXcW EGGITXERGIERHSVWXSVEKISJ'YWXSQIVcW)UYMTQIRX CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 201 of 804 Z 'YWXSQIVWLEPPRSXTIVQMXER]SJ'YWXSQIVcW)UYMTQIRXXSFIWYGGIIHMRKGEPIRHEVQSRXLHYVMRKXLI0MGIRWI8IVQWLEPPFI VIQSZIHJVSQXLI0MGIRWIH%VIE[MXLSYXTVMSV[VMXXIRTEMHF]'YWXSQIVXS,SWXMREHZERGISRSVFIJSVIXLIJMVWX EYXLSVM^EXMSRJVSQ,SWX'YWXSQIV[MPPTVSZMHI,SWX[MXLHE]SJIEGLERHIZIV]WYGLGEPIRHEVQSRXLTVSZMHIH [VMXXIRRSXMJMGEXMSREXPIEWXX[S  FYWMRIWWHE]WFIJSVIXLILS[IZIVXLEXMRIZIRX'YWXSQIVMWYREFPIXSYWIXLI0MGIRWIH HEXIXLEX'YWXSQIVMRXIRHWXSVIQSZIER])UYMTQIRXJVSQXLI%VIEGSQQIRGMRKSRXLI7GLIHYPIH-RWXEPPEXMSR(EXIWSPIP]EW 0MGIRWIH%VIE4VSQTXP]JSPPS[MRK[VMXXIREYXLSVM^EXMSRF]EVIWYPXSJHIPE]WGEYWIHF],SWXXLIR'YWXSQIVcWSFPMKEXMSR ,SWX'YWXSQIVWLEPPVIQSZIMXW)UYMTQIRX'YWXSQIV[MPPFIXSTE]XLI0MGIRWI*IIWLEPPRSXGSQQIRGIYRXMPWYGLXMQIEW WSPIP]VIWTSRWMFPIJSVVIPSGEXMRKER]WYGL)UYMTQIRXERHJSV,SWXMWEFPIXSTVSZMHIWYGL0MGIRWIH%VIE'YWXSQIVLIVIF] ER]HEQEKIWGEYWIHF]SVMRGSRRIGXMSR[MXLXLIVIQSZEPSJEGORS[PIHKIWERHEKVIIWXLEXMRRSIZIRXWLEPP,SWXFIPMEFPI WYGL)UYMTQIRXXS'YWXSQIVJSVER]WYGLHIPE]SVJEMPYVISXLIVXLERXLI EFEXIQIRXSJ0MGIRWI*IIEWWIXJSVXLMRXLMW7IGXMSR H 'VSWW'SRRIGXW)\GITXEWSXLIV[MWIWTIGMJMGEPP]2SX[MXLWXERHMRKXLIJSVIKSMRKMRXLIIZIRXXLEXER]WYGL TVSZMHIHMRER]7IVZMGI3VHIV'YWXSQIVWLEPPRSXEPPS[ER]HIPE]MWEXXLIVIUYIWXSJ'YWXSQIVSVSXLIV[MWIVIWYPXWMR )UYMTQIRXXSFIGSRRIGXIHXSER]XLMVHTEVX]RIX[SVOWSV[LSPISVTEVXJVSQ'YWXSQIVcWJEMPYVIXSWEXMWJ]ERHTIVJSVQ W]WXIQWJSVER]TYVTSWI[MXLSYX M XLITVMSV[VMXXIRGSRWIRXEPPSFPMKEXMSRWVIUYMVIHXSFIWEXMWJMIHERHTIVJSVQIHF] SJ,SWXMRIEGLMRWXERGIERH MM GSQTPMERGI[MXLXLI'YWXSQIVSRSVFIJSVIWYGL7GLIHYPIH-RWXEPPEXMSR(EXIXLIR VIQEMRMRKTVSZMWMSRWSJXLMWTEVEKVETL-RXLIIZIRX'YWXSQIVMRIMXLIVGEWI M 'YWXSQIVWLEPPTE]XS,SWXYTSRHIQERHMR HIWMVIWXSSFXEMRHEXEGSQQYRMGEXMSRWERHSV-RXIVRIXWIVZMGIWEHHMXMSRXSXLIEQSYRXWSXLIV[MWITE]EFPILIVIYRHIVEPPGSWXW HMVIGXP]JVSQEXLMVHTEVX]GEVVMIV d8LMVH4EVX]7IVZMGIWe MRGYVVIHF],SWXEWEVIWYPXSJWYGLHIPE]XSKIXLIV[MXLEPP 'YWXSQIVWLEPPTVSZMHI,SWX[MXLE[VMXXIRVIUYIWXJSVGSRWIRXETTPMGEFPIJIIWWIVZMGIGLEVKIWEHQMRMWXVEXMZIJIIWERH XSGSRRIGXXSWYGLXLMVHTEVX]cWW]WXIQSVRIX[SVO[LMGLGERGIPPEXMSRJIIWEX,SWXcWXLIRGYVVIRXVEXIWERH MM  VIUYIWXWLEPPMHIRXMJ]XLIXLMVHTEVX]TVSZMHIVERHXLIXIVQWSJ'YWXSQIVcWSFPMKEXMSRXSTE]XLI0MGIRWI*IIWLEPPGSQQIRGI WYGLWIVZMGIW XLId8LMVH4EVX]8IVQWe XSKIXLIV[MXLERSRXLI7GLIHYPIH-RWXEPPEXMSR(EXIIZIRMJ'YWXSQIVcW I\IGYXIH7IVZMGI3VHIVJSVEPPRIGIWWEV]GVSWWGSRRIGXWERHIUYMTQIRX[EWRSXJYPP]MRWXEPPIHERHEWSJWYGL TE]QIRXSJXLIETTPMGEFPIGVSWWGSRRIGXJIIWWTIGMJMIHMRWYGL 'SQQIRGIQIRX(EXI 7IVZMGI3VHIV-RXLIIZIRX,SWXGSRWIRXWXSWYGLGSRRIGXMSR [LMGLWLEPPFIMRMXWWSPIHMWGVIXMSR 'YWXSQIVWLEPPFIWSPIP]-2796%2')6)59-6)1)287 VIWTSRWMFPIJSVTPEGMRKSVHIVW[MXLWYGLXLMVHTEVX]GEVVMIVWJSV ER]PSGEPERHPSRKHMWXERGIPMRIWXSFITVSZMHIHF]WYGLXLMVH E 'YWXSQIV[MPPOIITMRJYPPJSVGIERHIJJIGXEXEPP TEVX]GEVVMIVWERHGSQTP]MRK[MXLEPP8LMVH4EVX]8IVQWERHXMQIWHYVMRKXLI0MGIRWI8IVQ M GSQTVILIRWMZIKIRIVEP ETTPMGEFPIPE[VIPEXIHXSWYGL8LMVH4EVX]7IVZMGIW8LIXLMVHPMEFMPMX]MRWYVERGIMREREQSYRXRSXPIWWXLERSRIQMPPMSR TEVX]GEVVMIVWcMRWXEPPIHGMVGYMXWQYWXFIMR'YWXSQIVcWREQIHSPPEVW  TIVSGGYVVIRGIERHRSXPIWWXLERX[S ERHFMPPIHHMVIGXP]XS'YWXSQIV'YWXSQIVEKVIIWXSHIJIRHQMPPMSRHSPPEVW  MRXLIEKKVIKEXIJSVFSHMP] MRHIQRMJ]ERHLSPHLEVQPIWW,SWXMXWHMVIGXSVWSJJMGIVWMRNYV]ERHTVSTIVX]HEQEKI MM IQTPS]IV WPMEFMPMX]MRWYVERGI IQTPS]IIWEJJMPMEXIWERHGYWXSQIVWJVSQERHEKEMRWXER]ERHMREREQSYRXRSXPIWWXLERSRIQMPPMSRHSPPEVW   EPPGPEMQWEGXMSRWHIQERHWGSWXWERHI\TIRWIWMRGPYHMRKTIVSGGYVVIRGI MMM [SVOIVW GSQTIRWEXMSRMRWYVERGIMRER [MXLSYXPMQMXEXMSREXXSVRI]WcJIIWGSWXWERHI\TIRWIW[LMGLEQSYRXRSXPIWWXLERXLEXVIUYMVIHF]ETTPMGEFPIPE[ EVIMRER][E]HMVIGXP]SVMRHMVIGXP]FEWIHSRVIPEXIHXSSV MZ I\XIRHIHVMWOMRWYVERGIGSZIVMRKEPPSJGYWXSQIVcW EVMWMRKMRGSRRIGXMSR[MXLER]WYGL8LMVH4EVX]7IVZMGIWIUYMTQIRXERHSXLIVTIVWSREPTVSTIVX] MRGPYHMRKHEXEERH QIHME XSGSZIVXLIVITPEGIQIRXGSWXSJWEQIMRGPYHMRKFYX *))7RSXPMQMXIHXS)(4 IPIGXVSRMGHEXETVSGIWWMRKTVSTIVX] TIVMPW [VMXXIRSREd7TIGMEP*SVQeFEWMWEXJYPPVITPEGIQIRXGSWX  E 8LI*IIWTE]EFPIF]'YWXSQIVMRVIWTIGXSJXLIZEPYIERH Z GSZIVEKIJSVXLIGSRXVEGXYEPPMEFMPMX]SJ 'SPSGEXMSR0MGIRWIWLEPPMRGPYHI M ER]ERHEPPWIXYTJIIW'YWXSQIVXSMRHIQRMJ],SWX'YWXSQIVWLEPPTPEGIXLITSPMGMIW EGXMZEXMSRJIIWIUYMTQIRXJIIWERHSVSXLIVSRIXMQI*IIWVIUYMVIHLIVIMR[MXLEGEVVMIVLEZMRKER%1&IWXVEXMRKSJ% VIPEXIHXSXLI'SPSGEXMSR0MGIRWIEWWIXJSVXLMRXLIETTPMGEFPI:---SVFIXXIV'YWXSQIVEPWSI\TVIWWP]EKVIIWXLEXMX[MPPFI 7IVZMGI3VHIV GSPPIGXMZIP]d7IX9T*IIWe  MM EQSRXLP]WSPIP]VIWTSRWMFPIJSVIRWYVMRKXLEXMXWEKIRXW MRGPYHMRK VIGYVVMRKJIIJSVXLI'SPSGEXMSR0MGIRWIMRXLIEQSYRXWIXGSRXVEGXSVWERHWYFGSRXVEGXSVW QEMRXEMREHHMXMSREPMRWYVERGI JSVXLMRXLIETTPMGEFPI7IVZMGI3VHIV d0MGIRWI*IIe ERH MMM EXPIZIPWRSPIWWXLERXLSWIVIUYMVIHF]ETTPMGEFPIPE[ERH ER]SXLIV*IIWWIXJSVXLMRXLIETTPMGEFPI7IVZMGI3VHIVSVGYWXSQEV]MR'YWXSQIVcWERHMXWEKIRXWcMRHYWXVMIW4VMSVXS SXLIV[MWIEVMWMRKTYVWYERXXSER]SXLIVTVSZMWMSRSJXLIMRWXEPPEXMSRSJER]SJ'YWXSQIVcW)UYMTQIRXMRXLI*EGMPMX]SV %KVIIQIRXSXLIV[MWI'YWXSQIV[MPPJYVRMWL,SWX[MXLGIVXMJMGEXIWSJ MRWYVERGI[LMGLIZMHIRGIXLIQMRMQYQPIZIPWSJMRWYVERGIWIX F -JXLMW%HHIRHYQMWFIMRKI\IGYXIHWMQYPXERISYWJSVXLEFSZIREQI,SWXEWEHHMXMSREPMRWYVIHVIUYMVI [MXLXLII\IGYXMSRSJ'YWXSQIVcW1EWXIV7IVZMGIW%KVIIQIRXRSXMJMGEXMSRSJ,SWXMR[VMXMRKSJXLIIJJIGXMZIHEXISJWYGL MI'YWXSQIVMWERI[GYWXSQIVJSV,SWXERHLEWRSXGSZIVEKIERHTVSZMHIXLEXEPPMRWYVERGITSPMGMIWTVSZMHI,SWX TVIZMSYWP]EGUYMVIHSXLIV7IVZMGIW EPP7IX9T*IIWXSKIXLIV[MXLXLMVX]  HE]WEHZERGIH[VMXXIRRSXMGISJGERGIPPEXMSRSV [MXLXLI0MGIRWI*IIJSVXLIJMVWXQSRXLSJXLI0MGIRWI8IVQXIVQMREXMSR WLEPPFITEMHF]'YWXSQIVXS,SWXMREHZERGIEXSVTVMSVXS XLIXMQI'YWXSQIVWYFQMXWMXWWMKRIH7IVZMGI3VHIVJSV F 'YWXSQIVERHMXWEKIRXWERHVITVIWIRXEXMZIWWLEPP EGGITXERGIF],SWX-JXLMW%HHIRHYQMWFIMRKI\IGYXIHWYGLRSXTYVWYIER]GPEMQWEKEMRWX,SWXJSVER]PMEFMPMX],SWXQE] XLEX'YWXSQIV[MPPFIEGUYMVMRKEREHHMXMSREP7IVZMGISVLEZIYRHIVSVVIPEXMRKXSXLMW%KVIIQIRXYRPIWWERHYRXMP 7IVZMGIWJVSQ,SWXEPPWIXYTJIIW[MPPFIMRGPYHIHSR'YWXSQIVSV'YWXSQIVcWIQTPS]IIEWETTPMGEFPIJMVWXQEOIW 'YWXSQIVcWRI\XQSRXLP]MRZSMGI8LI0MGIRWI*IIJSVIEGLGPEMQWEKEMRWX'YWXSQIVcWMRWYVERGITVSZMHIV W ERHWYGL CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 202 of 804 Z MRWYVERGITVSZMHIV W JMREPP]VIWSPZI W WYGLGPEMQW%R]SXLIVTVSTIVX]JVSQXLI*EGMPMX]ERHVIWXSVIXLI0MGIRWIH%VIE MREFMPMX]F]'YWXSQIVXSJYVRMWLXLITVSSJSJMRWYVERGIXSXLIWEQIGSRHMXMSREWMX[EWTVMSVXSWYGL)UYMTQIRXcW VIUYMVIHYRHIVXLMW7IGXMSRSVJEMPYVIXSSFXEMRWYGLMRWYVERGIMRWXEPPEXMSR-J'YWXSQIVHSIWRSXVIQSZIWYGLTVSTIVX] SV WLEPPFIEQEXIVMEPFVIEGLSJXLMW%KVIIQIRX'YWXSQIVERHEPPGERRSXVIQSZIWYGLTVSTIVX]FIGEYWISJYRTEMHEQSYRXWHYI TEVXMIWGPEMQMRKYRHIVF]ERHXLVSYKL'YWXSQIVLIVIF][EMZIXS,SWX [MXLMRWYGLXIR  HE]TIVMSHXLIR,SWXQE]QSZI ER]ERHEPPVMKLXWXSVIGSZIVEKEMRWX,SWXSVSXLIVXIRERXWER]ERHEPPWYGLTVSTIVX]XSWXSVEKIERHGLEVKI'YWXSQIVJSV GYWXSQIVWSVSGGYTERXWSJXLI*EGMPMX]SVEKEMRWXXLIMVSJJMGIVWWYGLVIQSZEPERHWXSVEKI[MXLSYXFIMRKPMEFPIJSVVIPEXIH HMVIGXSVWWLEVILSPHIVWTEVXRIVWQIQFIVWIQTPS]IIWEKIRXWHEQEKIW-J'YWXSQIVHSIWRSXTE]EPPEQSYRXWHYIXS,SWX GYWXSQIVWSVMRZMXIIWJSVER]PSWWSVHEQEKIXSWYGL[EMZMRKERHVIQSZIWYGLTVSTIVX]JVSQ,SWXcWTVIQMWIWSVWXSVEKI TEVX]JVSQER]GEYWIGSZIVIHF]ER]MRWYVERGIVIUYMVIHXSFI[MXLMRXLMVX]  HE]WSJ,SWXcWVIUYIWX,SWXQE]WIPPXLI GEVVMIHF]ER]WYGLTEVX]LIVIYRHIVXSXLII\XIRXMRWYVIH)UYMTQIRXERHER]SXLIVWYGLTVSTIVX]MRER]GSQQIVGMEPP] ,SWXMXWEKIRXWERHIQTPS]IIWQEOIRSVITVIWIRXEXMSRXLEXXLIVIEWSREFPIQERRIVERHQE]YWIEQSYRXWVIGIMZIHXSWEXMWJ] PMQMXWSJPMEFMPMX]WTIGMJMIHXSFIGEVVMIHF]'YWXSQIVTYVWYERXER]ERHEPPEQSYRXWHYIXS,SWXTVSZMHIHXLEX M ,SWXWLEPP XSXLMW7IGXMSREVIEHIUYEXIXSTVSXIGX'YWXSQIVRSXFIPMEFPIXS'YWXSQIVJSVER]HEQEKIWMRGSRRIGXMSR[MXL WYGL)UYMTQIRXSVXLIWEPISJWYGL)UYMTQIRXERH MM ,SWXcW 7)'96-8=,SWXHSIWRSXKYEVERXIIWIGYVMX]SJVIGIMTXSJEQSYRXWJVSQXLIWEPISJWYGL)UYMTQIRXWLEPPSRP] 'YWXSQIVcW)UYMTQIRXXLI*EGMPMX]SV,SWXcWGSQTYXIVWWEXMWJ]'YWXSQIVcWSFPMKEXMSRWXS,SWXMJ,SWXVIGIMZIWER RIX[SVOLYFWERHTSMRXWSJTVIWIRGI'YWXSQIVERHIEGLSJEQSYRXEXPIEWXIUYEPXSXLIEQSYRXWSS[IHERHVIGIMTXSJPIWW MXWIQTPS]IIWWLEPPGSQTP][MXLXLI,SWX'SPSGEXMSR%GGIWWXLERXLIJYPPEQSYRXS[IHWLEPPRSXTVIZIRXSVPMQMX,SWXcW 4SPMG]ERH4VSGIHYVIWEWEQIRHIHJVSQXMQIXSXMQIVMKLXXSTYVWYIER]HIJMGMIRG]JVSQ'YWXSQIV'YWXSQIV[MPP 'YWXSQIVLEWVIZMI[IHXLIGYVVIRXZIVWMSRSJWYGLTVSGIHYVIWLEZIRSVMKLXXSVIQEMRMRTSWWIWWMSRSJEPPSVER]TEVXSJXLI %R]EQIRHQIRXWXLIVIXSWLEPPFIIJJIGXMZIYTSRTSWXMRKMRE0MGIRWIH%VIEEJXIVXLII\TMVEXMSRSVIEVPMIVXIVQMREXMSRSJXLI GSRWTMGYSYWPSGEXMSREXXLI*EGMPMX]%KVIIQIRXSVXLI0MGIRWI8IVQ-J'YWXSQIVVIQEMRWMR TSWWIWWMSRSJEPPSVER]TEVXSJXLI0MGIRWIH%VIEEJXIVER] %'')77838,)0-')27)(%6)%,SWXLIVIF]WYGLI\TMVEXMSRSVIEVPMIVXIVQMREXMSR[MXLXLII\TVIWW[VMXXIR EKVIIWXSTVSZMHILSYVTIVHE]HE]TIV[IIOWIGYVIHGSRWIRXSJ,SWX d,SPHSZIV4IVMSHe  \ WYGLVMKLX[MPPFI EGGIWWXSXLI0MGIRWIH%VIEJSVXLIEYXLSVM^IHTIVWSRRIPPMWXIHHIIQIHXSFIETIVMSHMGPMGIRWIJVSQQSRXLXSQSRXLSRP] F]'YWXSQIVSR,SWXcWWXERHEVH'YWXSQIV%YXLSVM^IH'SRXEGX d,SPHSZIV0MGIRWIe  ] WYGL,SPHSZIV0MGIRWI[MPPRSX 0MWXJSVQ EWEQIRHIHJSVQXMQIXSXMQIXLId'YWXSQIVGSRWXMXYXIEVIRI[EPSVI\XIRWMSRSJXLI%KVIIQIRXSVXLI %YXLSVM^IH'SRXEGX0MWXe WYFNIGXXSXLIXIVQWERHGSRHMXMSRW'SPSGEXMSR0MGIRWIJSVER]JYVXLIVXIVQERH ^ WYGL GSRXEMRIHMRXLI%GGIWW%YXLSVMX]+YMHIPMRIWTSWXIHF],SWX,SPHSZIV0MGIRWIQE]FIXIVQMREXIHF],SWXYTSRXLIIEVPMIV EX[[[,SWXRIXEEK EWXLIWEQIQE]FIEQIRHIHJVS [[1127,1589,1275,1628][8][,,][Arial]]QXMQI [[1328,1589,2075,1628][8][,,][Arial]]SJJMJXIIR  HE]W TVMSV[VMXXIRRSXMGISVXLII [[2041,1589,2247,1628][8][,,][Arial]]EVPMIWXHEXI XSXMQIXLId%GGIWW%YXLSVMX]+YMHIPMRIWe ,SWXQE]TIVQMXXIHF]PE['YWXSQIVWLEPPTE],SWXEVIGYVVMRK WYWTIRHXLIVMKLXSJER]EYXLSVM^IHTIVWSRRIPSVSXLIVTIVWSRWQSRXLP]JIISRSVTVMSVXSXLIJMVWXHE]SJIEGLGEPIRHEVQSRXL XSZMWMXXLI,SWXTVIQMWIWERHSVXLI*EGMPMX]EXER]XMQIMRHYVMRKER],SPHSZIV4IVMSHMREREQSYRXIUYEPXSX[SXMQIW ,SWXcWVIEWSREFPIHMWGVIXMSRXLIQSRXLP]0MGIRWI*IIXLEX[EWTE]EFPIHYVMRKXLIPEWX QSRXLSJ'SPSGEXMSR0MGIRWI d,SPHSZIV0MGIRWI*IIe ERH 6)03'%8-323*)59-41)28,SWXWLEPPFIER]SXLIVWYQWHYIYRHIVXLMW%KVIIQIRX[MPPFITE]EFPIMR IRXMXPIHYTSRVIEWSREFPI[VMXXIRRSXMGIXS'YWXSQIVXSXLIEQSYRXERHEXXLIXMQIWWTIGMJMIHMRXLMW%KVIIQIRX-R GLERKIXLI0MGIRWIH%VIEEPPSGEXIHJSV'YWXSQIVcWIUYMTQIRXEHHMXMSRXSXLITE]QIRXSJXLI,SPHSZIV0MGIRWI*IIERHER] SVXSGLERKIXLIPSGEXMSRSJXLI*EGMPMX]XSEHMJJIVIRXPSGEXMSRERHEPPEHHMXMSREPJIIWSXLIV[MWIHYIYRHIVXLI%KVIIQIRX ,SWXWLEPPFIEVEPPGSWXWSJWYGLGLERKIWERHVIPSGEXMSR'YWXSQIVWLEPPFIPMEFPIXS,SWXJSVEPPGSWXWGPEMQWPSWWIWSV MRGPYHMRKVIGEFPMRKXLMVHTEVX]GERGIPPEXMSRGLEVKIWERHPMEFMPMXMIW MRGPYHMRKEXXSVRI]WcJIIW [LMGL,SWXQE]MRGYVEW QSZMRK-RXLIIZIRXSJWYGLVIPSGEXMSRXLITEVXMIWWLEPP[SVOEVIWYPXSJ'YWXSQIVcWJEMPYVIXSWYVVIRHIVTSWWIWWMSRSJXLI XSKIXLIVMRKSSHJEMXLXSQMRMQM^IER]HMWVYTXMSRWSJ0MGIRWIH%VIEXS,SWXYTSRXLII\TMVEXMSRSVIEVPMIV 'YWXSQIVcWSTIVEXMSRWEVMWMRKJVSQXLIGLERKISVVIPSGEXMSRXIVQMREXMSRSJXLMW%KVIIQIRXSVXLI0MGIRWI8IVQ-RRS[E] WYGLKSSHJEMXLIJJSVXWWLEPPMRGPYHIRIKSXMEXMSRSJETPERERHWLEPPXLI,SPHSZIV0MGIRWI*IISVER]SXLIVQSRIXEV]SVRSR WGLIHYPIJSVVIPSGEXMRKXLI0MGIRWIH%VIEMJETTPMGEFPI%PPQSRIXEV]VIUYMVIQIRXWWIXJSVXLMRXLMW%KVIIQIRXFI VIPSGEXIHJEGMPMXMIW0MGIRWIH%VIEGSRRIGXMSRWGSRHYMXWGSRWXVYIHXSGSRWXMXYXIPMUYMHEXIHHEQEKIWJSV,SWXcWPSWW ERHSVGEFPIWWLEPPFITVSZMHIHMREGGSVHERGI[MXLXLIXIVQWVIWYPXMRKJVSQ'YWXSQIVcWLSPHSZIV%R],SPHSZIV0MGIRWI ERHGSRHMXMSRWWIXJSVXLMRXLMW%KVIIQIRX-RXLIIZIRX,SWXGVIEXIHLIVIF][MPPFIWYFNIGXXSIZIV]SXLIVXIVQGSRHMXMSR TVSZMHIWRSXMGISJMXWMRXIRXXSGLERKIXLI0MGIRWIH%VIESVERHGSZIRERXGSRXEMRIHMRXLMW%KVIIQIRX PSGEXMSRSJXLI*EGMPMX]XSEHMJJIVIRXKISKVETLMGPSGEXMSRERH 'YWXSQIVHSIWRSXJMRHXLIGLERKIVIEWSREFP]WEXMWJEGXSV]JSV MXWTYVTSWIW'YWXSQIVWLEPPLEZIXLIVMKLXXSXIVQMREXIXLI 'SPSGEXMSR0MGIRWIYTSRXIR  FYWMRIWWHE]WcTVMSV[VMXXIR RSXMGIXS,SWXMRHMGEXMRK'YWXSQIVcWHIWMVIXSXIVQMREXIXLI 'SPSGEXMSR0MGIRWITYVWYERXXSXLMW7IGXMSR )**)'83*8)61-2%8-32*SPPS[MRKXLII\TMVEXMSR SVXIVQMREXMSRSJXLI%KVIIQIRXSVXLI0MGIRWI8IVQ[MXLMR XIR  HE]WSJ,SWXcWVIUYIWX ERHSRP]EJXIV'YWXSQIV VIGIMZIWEYXLSVM^EXMSRJVSQ,SWX 'YWXSQIVWLEPPEXMXWWSPI GSWXERHI\TIRWIVIQSZIEPPSJ'YWXSQIVcW)UYMTQIRXERH CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC ,SWX2IX-RMXMEPW'YWXSQIV-RMXMEPW Page 203 of 804 Z 2)8;36/7)6:-')7%(()2(91 XS1EWXIV7IVZMGIW%KVIIQIRX 8LMW2IX[SVO7IVZMGIW%HHIRHYQ XLMWd%HHIRHYQe XS1EWXIV7IVZMGIW%KVIIQIRXHIWGVMFIWEHHMXMSREPXIVQWERHGSRHMXMSRWYRHIV [LMGL,SWX[MPPTVSZMHI'YWXSQIV[MXLSRISVQSVISJXLI2IX[SVO7IVZMGIW 1IXVS)XLIVRIX-RXIVRIXEGGIWW XVERWMX 1YPXMREXMSREP8VERWTSVX 1YPXMTVSXSGSP0EFIP7[MXGLMRK 1407 *VEQI6IPE]1EREKIH-RXIVRIX7IVZMGI 1-7 4SMRXXS4SMRX3'\3R2IXERH(70WIVZMGIW MHIRXMJMIHMR E7IVZMGI3VHIV%PPGETMXEPM^IHXIVQWYWIHFYXRSXSXLIV[MWIHIJMRIHMRXLMW%HHIRHYQWLEPPLEZIXLIQIERMRKWEWGVMFIHXSXLIQMRXLI8IVQWERH 'SRHMXMSRW[LMGLJSVQETEVXSJXLI1EWXIV7IVZMGIW%KVIIQIRX 2)8;36/7)6:-')7 ,SWXWLEPPTVSZMHIXS'YWXSQIVJMVWXQSRXLSJXLI7IVZMGI8IVQWLEPPFITEMHF]'YWXSQIVXS,SWXMR ERH'YWXSQIVWLEPPTYVGLEWIJVSQ,SWXXLI2IX[SVO7IVZMGIWWTIGMJMIHEHZERGIEXSVTVMSVXSXLIXMQI'YWXSQIVWYFQMXWMXWWMKRIH7IVZMGI MRXLIETTPMGEFPI7IVZMGI3VHIV3VHIVJSVEGGITXERGIF],SWX-JXLMW%HHIRHYQMWFIMRKI\IGYXIHWYGL XLEX'YWXSQIV[MPPFIEGUYMVMRKEREHHMXMSREP7IVZMGISV7IVZMGIWJVSQ 7)6:-')8)61 )\GITXEWSXLIV[MWITVSZMHIHIPWI[LIVIMR,SWXEPPWIXYTJIIW[MPPFIMRGPYHIHSR'YWXSQIVcWRI\XQSRXLP] XLI%KVIIQIRXXLI7IVZMGI8IVQJSVXLI2IX[SVO7IVZMGIWWLEPPMRZSMGI GSQQIRGIYTSRXLIHEXI,SWXWXEVXWTVSZMHMRK2IX[SVO7IVZMGIWXS G 'YWXSQIV d7IVZMGI'SQQIRGIQIRX(EXIe ERHYRPIWWVIRI[IHMR8LI7IVZMGI*IIWLEPPFITEMHF]'YWXSQIVXS,SWXSRSV EGGSVHERGI[MXLXLIVIQEMRMRKTVSZMWMSRWSJXLMWTEVEKVETLI\TMVIEXFIJSVIXLIJMVWXHE]SJIEGLERHIZIV]GEPIRHEVQSRXLHYVMRKXLITIVMSH XLIIRHSJXLIMRMXMEPTIVMSHWTIGMJMIHMRXLIETTPMGEFPI7IVZMGI3VHIV M GSQQIRGMRKSRXLIIEVPMIVSJXLI7GLIHYPIH-RWXEPPEXMSR(EXIERHXLI d-RMXMEP8IVQe %XXLII\TMVEXMSRSJXLI-RMXMEP8IVQERHIEGL7IVZMGI'SQQIRGIQIRX(EXI WYFNIGXXSTVITE]QIRXSJXLIJMVWX 6IRI[EP8IVQ EWLIVIEJXIVHIJMRIH MJER]XLI7IVZMGI8IVQWLEPPQSRXLP]MRWXEPPQIRXEWHIWGVMFIHEFSZI ERH MM GSRXMRYMRK EYXSQEXMGEPP]VIRI[YRMRXIVVYTXIHYRXMPXLII\TMVEXMSRSVXIVQMREXMSRSJXLI7IVZMGI8IVQ JSVEREHHMXMSREPQSRXLTIVMSHSVWYGLPSRKIV  IEGLETVSZMHIHLS[IZIVXLEXMRIZIRX'YWXSQIVMWYREFPIXSYWIXLI2IX[SVO VIRI[EPXIVQEWQE]FIWTIGMJMIHMRXLIETTPMGEFPI7IVZMGI3VHIV d6IRI[EP8IVQe YRPIWWIMXLIVTEVX]HIPMZIVW[VMXXIRRSXMGIXSXLISXLIV7IVZMGIWGSQQIRGMRKSRXLI7GLIHYPIH-RWXEPPEXMSR(EXIWSPIP]EWE TEVX]EXPIEWXHE]WTVMSVXSWYGLVIRI[EPMRHMGEXMRKMXWHIWMVIXSEPPS[VIWYPXSJHIPE]WGEYWIHF],SWXXLIR'YWXSQIVcWSFPMKEXMSRXSTE]XLI XLI7IVZMGI8IVQXSI\TMVIEXXLIWGLIHYPIHI\TMVEXMSRSJXLI-RMXMEP7IVZMGI*IIWLEPPRSXGSQQIRGIYRXMPXLI7IVZMGI'SQQIRGIQIRX(EXI 8IVQSVER]6IRI[EP8IVQXLIRMRIJJIGX'YWXSQIVLIVIF]EGORS[PIHKIWERHEKVIIWXLEXMRRSIZIRXWLEPP,SWX FIPMEFPIXS'YWXSQIVJSVER]WYGLHIPE]SVJEMPYVISXLIVXLERXLI %'8-:%8-323*2)8;36/7)6:-')7 -RXLIIZIRXMXEFEXIQIRXSJ7IVZMGI*IIEWWIXJSVXLMRXLMW7IGXMSR WLEPPFIRIGIWWEV]JSV,SWXXSTVSZMHIIUYMTQIRXXSFIMRWXEPPIHEX H 'YWXSQIVcWPSGEXMSR,SWX[MPPWLMTXLIRIGIWWEV]IUYMTQIRXXSXLI%R]SXLIV*IIWTE]EFPILIVIYRHIVWLEPPFITEMHF] 'YWXSQIVPSGEXMSRERHGSRXEGX'YWXSQIVXSWGLIHYPIERMRWXEPPEXMSRHEXI'YWXSQIVXS,SWXSRSVFIJSVIXLIETTPMGEFPI(YI(EXIHIXIVQMRIH d7GLIHYPIH-RWXEPPEXMSR(EXIe 'YWXSQIV[MPPTVITEVIMXWPSGEXMSRMRTYVWYERXXSXLMW%KVIIQIRXSVSXLIV[MWIWTIGMJMIHMRER]FMPPMRKMRZSMGI EHZERGIJSVXLIMRWXEPPEXMSRTVSZMHIEPP'YWXSQIVIUYMTQIRXVIUYMVIH &%2(;-(8,%00381)28 JSVXLIMRWXEPPEXMSRERHQEMRXEMRVIPIZERX'YWXSQIVTIVWSRRIPSRLERH)EGL7IVZMGI3VHIVJSV EWRIGIWWEV]JSVXLIMRWXEPPEXMSR-RXLIIZIRXXLIMRWXEPPEXMSRMWHIPE]IH2IX[SVO7IVZMGIWWLEPPMRGPYHI'YWXSQIVcWFERH[MHXLEPPSXQIRX EXXLIVIUYIWXSJ'YWXSQIVSVEWEVIWYPXSJ'YWXSQIVcWJEMPYVIXSWEXMWJ]VITVIWIRXMRKXLIEQSYRXSJFERH[MHXLXLEX'YWXSQIVWLEPPFITIVQMXXIH ERHTIVJSVQEPPSFPMKEXMSRWVIUYMVIHXSFIWEXMWJMIHERHTIVJSVQIHF]XSYWIIEGLGEPIRHEVQSRXL-J'YWXSQIVI\GIIHWXLMWEPPSXQIRXJSVER] 'YWXSQIVSRSVFIJSVIWYGL7GLIHYPIH-RWXEPPEXMSR(EXIXLIRMRIMXLIVVIEWSRMRER]GEPIRHEVQSRXLIZIRMJ'YWXSQIVLEWGERGIPPIHXLI GEWI'YWXSQIVWLEPPTE],SWX E EPPGSWXWMRGYVVIHF],SWXEWEVIWYPXETTPMGEFPI7IVZMGI8IVQHYVMRKXLIGEPIRHEVQSRXL'YWXSQIV[MPPFI SJWYGLHIPE] F EPPETTPMGEFPIJIIWWIVZMGIGLEVKIWEHQMRMWXVEXMZIGLEVKIHJSVWYGLSZIVEKIFERH[MHXL d&ERH[MHXL3ZIVEKI*IIWe EXE JIIWERHGERGIPPEXMSRJIIWEX,SWXcWXLIRGYVVIRXVEXIWERH G EPPVEXIMRGPYHIHMRXLI7IVZMGI3VHIV&ERH[MHXL3ZIVEKI*IIWWLEPPFI 7IVZMGI*IIW EWHIJMRIHFIPS[ JVSQXLI7GLIHYPIH-RWXEPPEXMSR(EXIFMPPIHMREVVIEVWERH'YWXSQIV[MPPVIGIMZIERMRZSMGIJSVSZIVEKI VIKEVHPIWWSJ[LIXLIV,SWXEGXYEPP]GSQTPIXIHXLIMRWXEPPEXMSRSVFIKERFERH[MHXLHYVMRKXLIQSRXLJSPPS[MRKXLIQSRXLMR[LMGLXLISZIVEKI TVSZMHMRK2IX[SVO7IVZMGIWEWSJWYGLHEXITVSZMHIHXLEX,SWXWLEPPSGGYVVIH%PPEQSYRXWWIXJSVXLMRER]WYGLMRZSMGIWLEPPFIHYI YWIGSQQIVGMEPP]VIEWSREFPIIJJSVXWERHGSSTIVEXI[MXL'YWXSQIVXSMQQIHMEXIP]YTSRVIGIMTX-XMW'YWXSQIVcWVIWTSRWMFMPMX]XSQSRMXSVMXW GSQTPIXIWYGLMRWXEPPEXMSRERHEGXMZEXIXLI2IX[SVO7IVZMGIWEWWSSREWFERH[MHXLYWEKIERHXSTE]JSVEPPSZIVEKIW,SWXVIWIVZIWXLIVMKLXXS VIEWSREFP]TVEGXMGEFPIEJXIV'YWXSQIVLEWGSQTPMIH[MXLMXWSFPMKEXMSRWQSRMXSV'YWXSQIVcWFERH[MHXLYWEKIERHXSYXMPM^IXIGLRSPSK]XSPMQMX YRHIVXLMW7IGXMSR'YWXSQIVcWFERH[MHXLYWEKIXSXLSWIEQSYRXWMRGPYHIHMRXLI ETTPMGEFPI7IVZMGI3VHIV W  *))7  8,-6(4%68=7)6:-')7 'YWXSQIVQE]IPIGXXSSFXEMR E 8LI*IIWTE]EFPIF]'YWXSQIVMRVIWTIGXSJ2IX[SVOJVSQXLMVHTEVXMIWWIVZMGIWXLEXEVIYXMPM^IHF]SV[LMGLYXMPM^ISRISV 7IVZMGIWWLEPPMRGPYHI M ER]ERHEPPWIXYTJIIWEGXMZEXMSRJIIWQSVISJXLI2IX[SVO7IVZMGIW GSPPIGXMZIP]d8LMVH4EVX]7IVZMGIWe  IUYMTQIRXJIIWERHSVSXLIVSRIXMQI*IIWVIPEXIHXSXLI2IX[SVO*SVI\EQTPI(70ERH:S-4VIUYMVIERHEVIHITIRHIRXYTSREWITEVEXI 7IVZMGIWEWWIXJSVXLMRXLIETTPMGEFPI7IVZMGI3VHIV GSPPIGXMZIP]d7IXFVSEHFERH2IX[SVOGSRRIGXMSR-RXLIIZIRX'YWXSQIVGLSSWIWXS 9T*IIWe EQSRXLP]VIGYVVMRKJIIJSVXLI2IX[SVO7IVZMGIWMRXLIYXMPM^IER]8LMVH4EVX]7IVZMGIWMRGSRRIGXMSR[MXLXLI2IX[SVO EQSYRXWIXJSVXLMRXLIETTPMGEFPI7IVZMGI3VHIV d7IVZMGI*IIe ERH7IVZMGIW'YWXSQIVEKVIIWXSHIJIRHMRHIQRMJ]ERHLSPHLEVQPIWW MMM ER]SXLIV*IIWWIXJSVXLMRXLIETTPMGEFPI7IVZMGI3VHIVSV,SWXMXWHMVIGXSVWSJJMGIVWIQTPS]IIWERHEJJMPMEXIWJVSQERHEKEMRWX SXLIV[MWIEVMWMRKTYVWYERXXSER]SXLIVTVSZMWMSRSJXLI%KVIIQIRXER]ERHEPPGPEMQWEGXMSRWHIQERHWGSWXWERHI\TIRWIWMRGPYHMRK MRGPYHMRK[MXLSYXPMQMXEXMSRER]&ERH[MHXL3ZIVEKI*IIW[LMGLQE][MXLSYXPMQMXEXMSREXXSVRI]WcJIIW[LMGLEVIMRER][E]HMVIGXP]SV FIGSQIHYITYVWYERXXS7IGXMSRFIPS[MRHMVIGXP]FEWIHSRVIPEXIHXSSVEVMWMRKMRGSRRIGXMSR[MXLER]WYGL 8LMVH4EVX]7IVZMGIW F -JXLMW%HHIRHYQMWFIMRKI\IGYXIHWMQYPXERISYW[MXLXLI I\IGYXMSRSJ'YWXSQIVcW1EWXIV7IVZMGIW%KVIIQIRX MI'YWXSQIVMWE RI[GYWXSQIVJSV,SWXERHMWRSXEGUYMVMRKSXLIV7IVZMGIWEXXLI )JJIGXMZI(EXI EPP7IX9T*IIWXSKIXLIV[MXLXLI7IVZMGI*IIJSVXLI CCCCCCCCCCCCC4EKISJCCCCCCCCCCCCC  ,SWXRIXMRMXMEPW'YWXSQIVMRMXMEPW Page 204 of 804 %88%',1)28837)6:-')36()6 2)8;36/7)6:-')7 8LI2IX[SVO7IVZMGIWMHIRXMJMIHMRXLI7IVZMGI3VHIVEVITVSZMHIHYTSRERHWYFNIGXXSXLI JSPPS[MRKEHHMXMSREPXIVQWERHGSRHMXMSRW 8IVQW%TTPMGEFPIXSEPP2IX[SVO7IVZMGIW E7IVZMGIWEVIGSZIVIHF],SWXRIX70%7II[[[LSWX [[1656,945,1805,997][11][,,][Arial]]RIXWPE [[1776,945,2212,997][11][,,][Arial]]JSVGSQTPIXIHIXEMPW F7YTTSVXTVSZMHIHF],SWXRIX'YWXSQIV'EVI8IEQ\\ZMETLSRIIQEMP ERHSRPMRI *SV,MKL7TIIH-RXIVRIX%GGIWW(IHMGEXIH-RXIVRIX8SRP] E-RGPYHIWPSGEPPSSTGMVGYMX F-J'YWXSQIVRIIHWXSQSZI8PSSTEQSZIJIIETTPMIW G7IVZMGIMRGPYHIWXLIYWEKISJEQEREKIHVSYXIV,SWXRIX[MPPTVSZMHIE8 GETEFPIVSYXIVXS'YWXSQIVJSVXLIQSRXLP]JIIWTIGMJMIHMRXLI7IVZMGI3VHIV 8LIVSYXIVVIQEMRWXLITVSTIVX]SJ,SWXRIXERHMWFIMRKQEHIEZEMPEFPIJSVYWI F]'YWXSQIVWSPIP]HYVMRKXLIXIVQSJXLMW7IVZMGI3VHIV8LIVSYXIV[MPPFI GSRJMKYVIHQEREKIHERHQEMRXEMRIHF],SWXRIXERHMWXSFIVIXYVRIHXS,SWXRIX YTSRXIVQMREXMSRSJXLI2IX[SVO7IVZMGIW *SV4SMRXXS4SMRX (7 SRP] E,SWXRIXMWTVSZMHMRK'YWXSQIV[MXLX[S  TSMRXXSTSMRX(7GSRRIGXMSRW FIX[IIRXLIPSGEXMSRWWTIGMJMIHSRXLI7IVZMGI3VHIV F8LI(7GMVGYMXW[MPPHIPMZIVIHXS'YWXSQIVcW434HIWGVMFIHSRXLI7IVZMGI 3VHIV G%R]EHHMXMSREPGVSWWGSRRIGXGLEVKIW[MPPFIXLIVIWTSRWMFMPMX]SJ'YWXSQIVMJ ETTPMGEFPIEXXLIJEGMPMX][LIVI'YWXSQIVcW434MWPSGEXIH H1SZIVIUYIWXWQYWXFIWYFQMXXIHXSEGGSYRXVITXSSFXEMRUYSXIJSVETTPMGEFPI JIIW *SV8VERWMXSRP] E1MRMQYQFEWIFERH[MHXLGSQQMXQIRXEWWTIGMJMIHMRXLI7IVZMGI3VHIVMW VIUYMVIHJSVXLIIRXMVIXIVQSJXLISVHIV F&YVWXEFPI-RXIVRIXEGGIWWYWEKIEFSZIFEWIFERH[MHXLWTIGMJMIHMRXLI7IVZMGI 3VHIV[MPPFIFMPPIHEXVEXITIVQIKEFMXWTIGMJMIHMRXLI7IVZMGI3VHIVFEWIHSR XL XLITIVGIRXMPIWXERHEVH G9RPIWWSXLIV[MWITVSZMHIHMRXLI7IVZMGI3VHIV'YWXSQIVMWVIWTSRWMFPIJSVEPP GVSWWGSRRIGXWXS,SWXRIX434 2IX[SVO7IVZMGIW%XXEGLQIRX 4EKISJ CCCCCCCCCCCCCCCCCCCCCCCCCC  ,SWXRIXMRMXMEPW'YWXSQIVMRMXMEPW Page 205 of 804 *SV1IXVS)XLIVRIXSRP] E4VIQMYQ1IXVS)XLIVRIX&YVWX1SHIGSRRIGXMSRWGEVV]E'-6'&;IUYEPXSXLI WYFWGVMFIH1IXVS)XLIVRIXFEWIFERH[MHXL8LIVIMWRSGLEVKIJSVFYVWXMRKSRXLI 1IXVS)XLIVRIXGSRRIGXMSRLS[IZIVFYVWXEFPIFERH[MHXLMRI\GIWWSJXLI '-6'&;VEXIMWFEWIHSRRIX[SVOEZEMPEFMPMX]ERHMWRSXKYEVERXIIH F1IXVS)XLIVRIXGLEVKIWPMWXIHEFSZIEVIFEWIHSREGSRRIGXMSRXSGYWXSQIV TVIQMWIQMPIWSVPIWWMRHMWXERGIJVSQXLIRIEVIWX6IKMSREP8IPGS1IXVS )XLIVRIXWIVZMGI[MVIGIRXIV%HHMXMSREP1MPIEKIGLEVKIWETTP]XS'YWXSQIV PSGEXMSRWKVIEXIVXLERQMPIW G,SWXRIXXSTVSZMHI'YWXSQIV[MXLEW[MXGLMRKHIZMGIJSVXLIXIVQSJXLI7IVZMGI 3VHIV7[MXGLXSFIGSRJMKYVIHQEREKIHERHQEMRXEMRIHF],SWXRIX7[MXGL VIQEMRWXLITVSTIVX]SJ,SWXRIXERHMWXSFIVIXYVRIHXS,SWXRIXYTSR XIVQMREXMSRSJWIVZMGIW H'YWXSQIVMWVIWTSRWMFPIJSVTVSZMHMRKEdGPIEVTEXLe EHIUYEXIGSRHYMXERHSV MRRIVHYGX[MXLTYPPWXVMRK JVSQHIWMVIHMRWXEPPTSMRX (1%6' MR'YWXSQIVcW SJJMGIXSXLI9XMPMX]IEWIQIRXEXIHKISJTVSTIVX],SWXRIXGERVIJIVYXMPMX] GSRXVEGXSVWYTSR'YWXSQIVVIUYIWX'YWXSQIVMWEPWSVIWTSRWMFPIJSVTVSZMHMRK XLIJSPPS[MRKFEWMG(1%6'VIUYMVIQIRXW1MRMQYQc\cTP][SSHFEGOFSEVH ZKVSYRHIHSYXPIX[MXL947HIZMGIERHKVSYRHMRKFEV I'YWXSQIVMWVIWTSRWMFPIJSVGVSWWGSRRIGXWEXFSXLPSGEXMSRW J%RMRWXEPPWMXIWYVZI][MPPFITIVJSVQIH-JXLIVIWYPXWSJXLIWMXIWYVZI] HIXIVQMRIXLEXEHHMXMSREPGLEVKIWJSVWTIGMEPGSRWXVYGXMSRETTP]MREHHMXMSRXSXLI %GXMZEXMSR7IXYT*IIWTIGMJMIHMRXLI7IVZMGI3VHIVERHSVXLIQSRXLP]VIGYVVMRK GLEVKI[MPPFIKVIEXIVXLERXLIEQSYRXWTIGMJMIHMRXLI7IVZMGI3VHIV'YWXSQIV [MPPLEZIXLISTXMSRXSE EKVIIXSTE]XLIEHHMXMSREPGLEVKIWSVF GERGIPXLI 1IXVS)XLIVRIXTSVXMSRSJXLIGSRXVEGXERHTE]EXIVQMREXMSRJIIEWWIWWIHF]XLI PSGEPXIPGS MJER] 4PIEWIRSXIXLMW[MPPFIETEWWXLVYGLEVKIXLEX[MPPFIEWWIWWIH EXXLIXMQISJGERGIPPEXMSR K&YVWXEFPI-RXIVRIXEGGIWWYWEKIEFSZIFEWIFERH[MHXLWTIGMJMIHMRXLI7IVZMGI 3VHIV[MPPFIFMPPIHEXXLIVEXITIVQIKEFMXWTIGMJMIHMRXLI7IVZMGI3VHIVFEWIH SRXLIXLTIVGIRXMPIWXERHEVH L-RWXEPPEXMSRXMQIJSV1IXVS)XLIVRIXGSRRIGXMSRWEZIVEKIWXSHE]W M-JXLI1IXVS)XLIVRIXGMVGYMXRIIHWXSFIQSZIHXSERSXLIVPSGEXMSRE QSZIJII[MPPFIETTPMIH *SV3R2IX8VERWTSVX 0SRK,EYP&IX[IIR'MXMIW SRP] E1MRMQYQFEWIFERH[MHXLGSQQMXQIRXEWWTIGMJMIHMRXLI7IVZMGI3VHIVMW VIUYMVIHJSVXLIIRXMVIXIVQSJXLISVHIV F9RPIWWSXLIV[MWITVSZMHIHMRXLI7IVZMGI3VHIV'YWXSQIVMWVIWTSRWMFPIJSVEPP GVSWWGSRRIGXWXS,SWXRIX434 2IX[SVO7IVZMGIW%XXEGLQIRX 4EKISJ CCCCCCCCCCCCCCCCCCCCCCCCCC  ,SWXRIXMRMXMEPW'YWXSQIVMRMXMEPW Page 206 of 804 *SV(70SRP] E%WXERHEVH%8 ,SWXcW(70WIVZMGI-JE WXERHEVH%8 (70WIVZMGI[MPPFIHIPMZIVIH SZIVXLEXPMRI-JRSXER%8 FISVHIVIH'YWXSQIVMW VIWTSRWMFPIJSVEPPGLEVKIWVIPEXIHXSWYGL%8 SRIPMRI *SV-R&YMPHMRK)XLIVRIX-RXIVRIX%GGIWWSRP] E&YVWXEFPI-RXIVRIXEGGIWWYWEKIEFSZIFEWIFERH[MHXLWTIGMJMIHMRXLI7IVZMGI 3VHIV[MPPFIFMPPIHEXXLIVEXITIVWTIGMJMIHMRXLI7IVZMGI3VHIVFEWIHSRXLI XL TIVGIRXMPIWXERHEVH F-RWXEPPEXMSR%GXMZEXMSRGLEVKIMRGPYHIWX]TMGEPMRWXEPPXSWXERHEVH(1%6' PSGEXMSR%HHMXMSREPGLEVKIWETTP]MJ(1%6'RIIHWXSFII\XIRHIHSVQSZIH G%GXMZEXMSR7IXYT*IIMWSRP]ERIWXMQEXI*IIQE]FILMKLIVFEWIHSREGXYEP GSWXSJXMQIERHQEXIVMEPWXSVYRER)XLIVRIXGSRRIGXMSRJVSQXLIRIEVIWX ,SWXRIXMRFYMPHMRKW[MXGLXS'YWXSQIVcWTSMRXSJMRWXEPP 2IX[SVO7IVZMGIW%XXEGLQIRX 4EKISJ CCCCCCCCCCCCCCCCCCCCCCCCCC  ,SWXRIXMRMXMEPW'YWXSQIVMRMXMEPW Page 207 of 804 IP Address Request HOST.NET 3500 NW Boca Raton Blvd, Bldg 900 ( %6-2.YWXMJMGEXMSR*SVQ  Boca Raton, FL 33431 Phone: (888) 556-iNOC FORM MUST BE TYPED Handwritten forms will be rejected Fax: (888) 882-4FAX   Online: www.host.net If current or new IP request equals a total IPv4 allocation of a /28 block (14 Useable or if you are requesting IPv6 addresses, this form is required. I. Company Information* Company Name: Phone: Accnt #(If existing): Fax: Service Information: (check appropriate service(s) that apply) Service: New Existing New IP Block Replace Existing Block Addition to Existing Block  In-Building Ethernet (IBE) On-Net Co-location / Virtual Svc. Dedicated Internet Access II. ARIN Contact Information* Existing ARIN OrgID: If you do not have an existing OrgID, please complete this section Organization Name: Organization Address: Organization City: Organization State: Organization Postal Code: Organization Country: Organization POC Name: Organization POC eMail: Organization POC Phone: Technical POC Name: Technical POC eMail: Technical POC Phone: III. Current IP Address Space Utilization Please list your current IP Address space (if any), including If, first IP issuance, skip this section. Provider Type of Use (DNS Servers, Routers, % in use Type Network Size Assigned By Hosting Servers etc) (IPv4 or IPv6) IV. IPv4 Address Space Request* (Please allow 3-7 business days for processing of your request. We may request additional information which could possibly extend the processing of your request.) Please list your requested IP Address space below. Host.net requires that each company submitting an initial IP request provide documentation establishing that they have: 1. An immediate need for at least 25% of the requested IP addresses, and 2. A one-year need for at least 50% of the requested IP addresses. A company submitting for additional IP address space must provide documentation that they have utilized at least 80% of their previously-assigned ve. CIDR Prefix: /24 /25 /26 /27 /28 /29 /30 IP Addresses: 254 126 62 30 14 6 2 Total Number of IP Addresses Immediate 3 Months 12 Months Route Destination Reason for Use Needed (use guide above) Usage Forecast Forecast Address Select use of IP's Select use of IP's Select use of IP's Select use of IP's Describe your planned usage of the requested IPv4 address space. If you are providing webhosting services and are doing IP-based hosting, please provide a list of technical reasons why named-based hosting cannot be done.  Host.net IP Address Request V7.0 02/01/11 Page 1 of 2 Page 208 of 804 IP Address Request HOST.NET 3500 NW Boca Raton Blvd, Bldg 900 ( %6-2.YWXMJMGEXMSR*SVQ  Boca Raton, FL 33431 Phone: (888) 556-iNOC FORM MUST BE TYPED Handwritten forms will be rejected Fax: (888) 882-4FAX   Online: www.host.net If current or new IP request equals a total IPv4 allocation of a /28 block (14 Useable or if you are requesting IPv6 addresses, this form is required. Statically Routed Customer, If so, will you require an additional /30 No Yes How would you like your space advertised? Customer Advertised BGP (Requires BGP form) No Yes DNS1: 64.135.1.20 DNS2: 64.135.2.30 Do you wish us to provide default reverse DNS? No Yes Do you wish reverse DNS to be delegated? No Yes Nameserver(s): V. IPv6 Address Space Request (Complete only if applicable) (Please allow 3-7 business days for processing of your request. We may request additional information which could possibly extend the processing of your request.) Host.net will issue a /56 to a company requesting IPv6 allocation unless this form indicates that the requesting company meets other requirements. Do you plan to issue IPv6 addresses to other companies or your customers? No Yes. If Yes, please detail your deployment plan in the space provided below. Statically Routed Customer Customer Advertised BGP (Requires BGP form) How would you like your space advertised? Do you intend to us No Yes DNS1: 2001:5b8:1::5 DNS2: 2001:5b8:1::7 Do you wish us to provide default reverse DNS? No Yes Do you wish reverse DNS to be delegated? No Yes Nameserver(s): VI. Additional Comments Please return the completed form to your Host.net Account Executive or the Network Operations Center. Failure to provide the requested details may cause a delay in provisioning your IP Address Space Request. Requested Authorization* smallest possible amount of address space possible necessary for my present and future needs. I understand that should I not reach the utilization thresholds prescribed by these policies, I may have my address space reassigned to a smaller block. I also have read and agree to be bound by H AUP and network management policies. Printed Name: Title: Signature: Date: Host.net IP Address Request V7.0 02/01/11 Page 2 of 2 Page 209 of 804 Page 210 of 804  Page 211 of 804 +SVER&ENVEQSZMG 1EREKMRK4EVXRIV  6IEP)JJIGXW-RXIVRIX+VSYT-RG 8IP 8IPI\X %VI]SYWIVMSYWEFSYX]SYVLSWXMRK#  '32*-()28-%0-8=238-') 8LMWIQEMPQIWWEKIJVSQ6IEP)JJIGXW-RXIVRIX+VSYT-RGQE]GSRXEMRMRJSVQEXMSRXLEXMWTVMZMPIKIHGSRJMHIRXMEPERHI\IQTXJVSQHMWGPSWYVI TVSTSWEP UYSXIIXG 8LMWIQEMPMWMRXIRHIHSRP]JSVXLIMRHMZMHYEPSVIRXMX]XS[LMGLMXMWEHHVIWWIH=SYEVILIVIF]RSXMJMIHXLEXER]HMWWIQMREXMSRHMWXVMFYXMSRSV GST]MRKSJXLMWGSQQYRMGEXMSRMWWXVMGXP]TVSLMFMXIH-J]SYVIGIMZIHXLMWIQEMPF]EGGMHIRXTPIEWIRSXMJ]XLIWIRHIVMQQIHMEXIP]ERHHIWXVS]XLMWIQEMP ERHEPPGSTMIWSJMX Page 212 of 804 6SPERHS1YRS^  (MVIGXSVSJ7EPIW  4LSRI  I\X (MVIGX   *E\   [[[ZSPMGSGSQ [[463,2027,513,2077][11][,,][Arial]]     Page 213 of 804               Page 214 of 804 6SPERHS1YRS^  (MVIGXSVSJ7EPIW  4LSRI  I\X (MVIGX   *E\   [[[ZSPMGSGSQ [[463,544,513,594][11][,,][Arial]]     ;IGERRSXPSWIXLMWSRI  7IRXJVSQQ]M4LSRI  &IKMRJSV[EVHIHQIWWEKI *VSQ :SPMGS,SWXMRK WEPIW$ZSPMGSGSQ" (EXI 3GXSFIVEX41)(8 8S WEPIW$ZSPMGSGSQQMGLEIP^VMLIR$KQEMPGSQ 7YFNIGX'SPSGEXMSR5YSXI6IUYIWX`'MX]SJ&S]RXSR&IEGL`'LEVPIW7XIZIRW  *VSQ'LEVPIW7XIZIRW 'SQTER]2EQI'MX]SJ&S]RXSR&IEGL )QEMP%HHVIWWWXIZIRWG$FFJPYW 4LSRI 'MX]&S]RXSR&IEGL 7XEXI*PSVMHE 4VIJIVVIH'SRXEGX1IXLSH4LSRI 7IVZMGI(EXI 7TEGI6IUYMVIQIRXW6EGO &ERH[MHXL6IUYMVIH1FTWSV+VIEXIV Page 215 of 804 'VSWW'SRRIGX6IUYMVIQIRXW 1EREKIH7IVZMGIW2SRI 7IVZMGI4VSZMHIV4EPQ&IEGL'SYRX]-77 %HHMXMSREP6IUYMVIQIRXW 7IRHIV W-4EHHVIWW {       Page 216 of 804 Page 217 of 804 Page 218 of 804 Page 219 of 804 Page 220 of 804 Page 221 of 804 Page 222 of 804 Page 223 of 804 Page 224 of 804 Page 225 of 804 Page 226 of 804 Page 227 of 804 Page 228 of 804 Page 229 of 804 Page 230 of 804 Page 231 of 804 Page 232 of 804 AMENDMENT NO.: 4 FINAL RENEWAL Office and Educational Consumables Contract No.: 618-000-11-1 This Amendment No. 4 (Amendment), is effective upon execution to Office and Educational Consumables No. 618- Contractor 000-11-1 (Contract) between the State of Florida, Department of Management Services (Department) and (Contractor). The Department and Contractor are collectively referred to herein as the (Parties). All capitalized terms used herein shall have the meaning assigned to them in the Contract, unless otherwise defined herein. WHEREASContractor the Department entered into a Contract with on October 18, 2010, which was renewed for one year effective October 17, 2013 and is scheduled to expire on October 17, 2014; and WHEREAS the Parties agree to renew the Contract, in accordance with its terms; and THEREFORE, in consideration of the mutual promises contained below, and other good and valuable consideration, receipt and sufficiency of which are hereby acknowledged, the Parties agree to the following: 1.0 Contract Renewal. Pursuant to section 4.26, the Contract is renewed for a period of two years effective October 17, 2014 and will expire October 17, 2016. 2.0 Contract Amendment. Pursuant to section 4.42, Paragraphs 5.14 and 5.15 are added to this Contract as follows: 5.14Scrutinized Company List Pursuant to subsection 287.135(5), F.S., by submitting a response to a procurement to which this clause is attached or by signing a contract or renewal of a contract where the value exceeds $1 million to which this clause is attached, the Respondent or Contractor certifies that it is not listed on either the Scrutinized Companies with Activities in Sudan List or the Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List, created pursuant to section 215.473, F.S. Pursuant to subsection 287.135(3)(b), F.S, Department may immediately terminate any contract for cause if the Contractor is found to have submitted a false certification under subsection 287.135(5), F.S., or if Contractor is placed on the Scrutinized Companies with Activities in Sudan List or the Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List during the term of the Contract. 5.15 Contractor - Public Records If, under this contract, the Contractor is providing services and is acting on behalf of the Department as provided under section 119.011(2), Florida Statutes, the Contractor, subject to the terms of section 287.058(1)(c), Florida Statutes, and any other applicable legal and equitable remedies, shall: (a) Keep and maintain public records that ordinarily and necessarily would be required by the Department in order to perform the service. (b) Provide the public with access to public records on the same terms and conditions that the Department would provide the records and at a cost that does not exceed the cost provided in Chapter 119, Florida Statutes, or as otherwise provided by law. (c) Ensure that public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed except as authorized by law. (d) Meet all requirements for retaining public records and transfer, at no cost, to the Department all public records in possession of the Contractor upon termination of the contract and destroy any duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. All records stored electronically must be provided to the Department in a format that is compatible with the information technology systems of the Department. The Department may unilaterally cancel this Contract for refusal by the Service Provider to comply with this section by not allowing public access to all documents, papers, letters, or other material made or received by the contractor in conjunction with the contract, unless the records are exempt from s. 24(a) of Art. I of the State Constitution and s. 119.07(1). Page 233 of 804 3.0 Effect. Unless otherwise modified by this Amendment, all terms and conditions contained in the Contract shall continue in full force and effect. 4.0 Conflict. To the extent any of the terms of this Amendment conflict with the terms of the Contract, the terms of this Amendment shall control.  5.0 Scrutinized Companies Activities 6.0 Warrant of Authority. Each person signing this Amendment warrants that he or she is duly authorized to do so and to bind the respective Party. 7.0 Successors and Assigns. This Amendment shall be binding upon and inure to the benefit of the successors and permitted assigns of the Parties hereto. 8.0 Entire Agreement. Except as expressly modified by this Amendment, the Contract shall be and remain in full force and effect in accordance with its terms and shall constitute the legal, valid, binding and enforceable obligations to the Parties. This Amendment and the Contract (including any written amendments thereto), collectively, are the complete agreement of the Parties and supersede any prior agreements or representations, whether oral or written, with respect thereto. State of Florida, Department of Management Contractor: Services: By: By: Name: Kelley J. Scott Name: Title: Director of State Purchasing and Title: Chief Procurement Officer Date: _ Date: Page 234 of 804 Page 235 of 804 Page 237 of 804 Page 238 of 804 Page 239 of 804 Page 240 of 804 Page 241 of 804 Page 242 of 804 Page 243 of 804 Page 244 of 804 Page 245 of 804 Page 246 of 804 Page 247 of 804 Page 248 of 804 Page 249 of 804 Page 250 of 804 Page 251 of 804 Page 252 of 804 Page 253 of 804 Page 254 of 804 Page 255 of 804 Page 256 of 804 Page 257 of 804 Page 258 of 804 Page 259 of 804 Page 260 of 804 Page 261 of 804 Page 262 of 804 Page 263 of 804 Page 264 of 804 Page 265 of 804 Page 266 of 804 Page 267 of 804 Page 268 of 804 Page 269 of 804 Page 270 of 804 Page 271 of 804 Page 272 of 804 Page 273 of 804 Page 274 of 804 Page 275 of 804 Page 276 of 804 Page 277 of 804 Page 278 of 804 Page 279 of 804 Page 280 of 804 Page 281 of 804 Page 282 of 804 Page 283 of 804 Page 284 of 804 Page 285 of 804 Page 286 of 804 Page 287 of 804 Page 288 of 804 Page 289 of 804 Page 290 of 804 Page 291 of 804 Page 292 of 804 Page 293 of 804 Page 294 of 804 Page 295 of 804 Page 296 of 804 Page 297 of 804 Page 298 of 804 Page 299 of 804 Page 300 of 804 Page 301 of 804 Page 302 of 804 Page 303 of 804 Page 304 of 804 Page 305 of 804 Page 306 of 804 Page 307 of 804 Page 308 of 804 Page 309 of 804 Page 310 of 804 Page 311 of 804 Page 312 of 804 Page 313 of 804 Page 314 of 804 Page 315 of 804 Page 316 of 804 Page 317 of 804 Page 318 of 804 Page 319 of 804 Page 320 of 804 Page 321 of 804 Page 322 of 804 Page 323 of 804 Page 324 of 804 Page 325 of 804 Page 326 of 804 Page 327 of 804 Page 328 of 804 Page 329 of 804 Page 330 of 804 Page 331 of 804 Page 332 of 804 Page 333 of 804 Page 334 of 804 Page 335 of 804 Page 336 of 804 Page 337 of 804 Page 338 of 804 Page 339 of 804 Page 340 of 804 Page 341 of 804 Page 342 of 804 Page 343 of 804 Page 344 of 804 Page 345 of 804 Page 346 of 804 Page 347 of 804 Page 348 of 804 Page 349 of 804 Page 350 of 804 Page 351 of 804 Page 352 of 804 Page 353 of 804 Page 354 of 804 Page 355 of 804 Page 356 of 804 Page 357 of 804 Page 358 of 804 Page 359 of 804 Page 360 of 804 Page 361 of 804 Page 362 of 804 Page 363 of 804 Page 364 of 804 Page 365 of 804 Page 366 of 804 Page 367 of 804 Page 368 of 804 Page 369 of 804 Page 370 of 804 Page 371 of 804 Page 372 of 804 Page 373 of 804 Page 374 of 804 Page 375 of 804 Page 376 of 804 Page 377 of 804 Page 378 of 804 Page 379 of 804 Page 380 of 804 Page 381 of 804 Page 382 of 804 Page 383 of 804 Page 384 of 804 Page 385 of 804 Page 386 of 804 Page 387 of 804 Page 388 of 804 Page 389 of 804 Page 390 of 804 Page 391 of 804 Page 392 of 804 Page 393 of 804 Page 394 of 804 Page 395 of 804 Page 396 of 804 Page 397 of 804 Page 398 of 804 Page 399 of 804 Page 400 of 804 Page 401 of 804 Page 402 of 804 Page 403 of 804 Page 404 of 804 Page 405 of 804 Page 406 of 804 Page 407 of 804 Page 408 of 804 Page 409 of 804 Page 410 of 804 Page 411 of 804 Page 412 of 804 Page 413 of 804 Page 414 of 804 Page 415 of 804 Page 416 of 804 Page 417 of 804 Page 418 of 804 Page 419 of 804 Page 420 of 804 Page 421 of 804 Page 422 of 804 Page 423 of 804 Page 424 of 804 Page 425 of 804 Page 426 of 804 Page 427 of 804 Page 428 of 804 Page 429 of 804 Page 430 of 804 Page 431 of 804 Page 432 of 804 Page 433 of 804 Page 434 of 804 Page 435 of 804 Page 436 of 804 Page 437 of 804 Page 438 of 804 Page 439 of 804 Page 440 of 804 Page 441 of 804 Page 442 of 804 Page 443 of 804 Page 444 of 804 Page 445 of 804 Page 446 of 804 Page 447 of 804 Page 448 of 804 Page 449 of 804 Page 450 of 804 Page 451 of 804 Page 452 of 804 Page 453 of 804 Page 454 of 804 Page 455 of 804 Page 456 of 804 Page 457 of 804 Page 458 of 804 Page 459 of 804 Page 460 of 804 Page 461 of 804 Page 462 of 804 Page 463 of 804 Page 464 of 804 Page 465 of 804 Page 466 of 804 Page 467 of 804 Page 468 of 804 Page 469 of 804 Page 470 of 804 Page 471 of 804 Page 472 of 804 Page 473 of 804 Page 474 of 804 Page 475 of 804 Page 476 of 804 Page 477 of 804 Page 478 of 804 Page 479 of 804 Page 480 of 804 Page 481 of 804 Page 482 of 804 Page 483 of 804 Page 484 of 804 Page 485 of 804 Page 486 of 804 Page 487 of 804 Page 488 of 804 Page 489 of 804 Page 490 of 804 Page 491 of 804 Page 492 of 804 Page 493 of 804 Page 494 of 804 Page 495 of 804 Page 496 of 804 Page 497 of 804 Page 498 of 804 Page 499 of 804 Page 500 of 804 Page 501 of 804 Page 502 of 804 Page 503 of 804 Page 504 of 804 Page 505 of 804 Page 506 of 804 Page 507 of 804 Page 508 of 804 Page 509 of 804 Page 510 of 804 Page 511 of 804 Page 512 of 804 Page 513 of 804 Page 514 of 804 Page 515 of 804 Page 516 of 804 Page 517 of 804 Page 518 of 804 Page 519 of 804 Page 520 of 804 Page 521 of 804 Page 522 of 804 Page 523 of 804 Page 524 of 804 Page 525 of 804 Page 526 of 804 Page 527 of 804 Page 528 of 804 Page 529 of 804 Page 530 of 804 Page 531 of 804 Page 532 of 804 Page 533 of 804 Page 534 of 804 Page 535 of 804 Page 536 of 804 Page 537 of 804 Page 538 of 804 Page 539 of 804 Page 540 of 804 Page 541 of 804 Page 542 of 804 Page 543 of 804 Page 544 of 804 Page 545 of 804 Page 546 of 804 Page 547 of 804 Page 548 of 804 Page 549 of 804 Page 550 of 804 Page 551 of 804 Page 552 of 804 Page 553 of 804 Page 554 of 804 Page 555 of 804 Page 556 of 804 Page 557 of 804 Page 558 of 804 Page 559 of 804 Page 560 of 804 Page 561 of 804 Page 562 of 804 Page 563 of 804 Page 564 of 804 Page 565 of 804 Page 566 of 804 Page 567 of 804 Page 568 of 804 Page 569 of 804 Page 570 of 804 Page 571 of 804 Page 572 of 804 Page 573 of 804 Page 574 of 804 Page 575 of 804 Page 576 of 804 Page 577 of 804 Page 578 of 804 Page 579 of 804 Page 580 of 804 Page 581 of 804 Page 582 of 804 Page 583 of 804 Page 584 of 804 Page 585 of 804 Page 586 of 804 Page 587 of 804 Page 588 of 804 DocuSign Envelope ID: 21A25245-EF97-4F4D-9C4D-5B229A95D2A4  Supplement to the SunGard Public Sector Inc. Application Service Provider Agreement Schedule A - Order Form This Schedule A - Order Form is entered into under the terms and conditions of the SunGard Public Sector Inc. Application Service Provider Agreement dated November 2, 2009 (Agreement), between SunGard Public Sector Inc.(SunGard Public Sector)City of Boynton Beach, FL(Customer) and . Unless otherwise stated below, all terms and conditions as stated in the Agreement shall remain in effect.   Customer Name: Yes No City of Boynton Beach, FL X Initial Order Form Agreement Number: BYB2-1173LG-141692-1 Replacement Order Form X 1. Initial Term: Begins January 1, 2015 and expires sixty (60) months from the date the initial Monthly Access Fee is due under this Schedule A Order Form. 2. Application Groups: Professional Services Fees and Monthly Access Fees Applications and/or ServicesProfessional Monthly Access Services FeesFee BYB2 091397-1 091397-2 091397-3 091397-4 091397-5 BYB2 N/A $ 16,199.00 Renewal Services091397-6 091397-7 BYB2 - 00006255 New Third Party ProductsCognos BI: Base Bundle Multi-Data Source- (BICOREMDS), Cognos Included in 1,137.98 (Not Currently Licensed)BI: Café (Analysis for Excel) - (COGNOS-C), Cognos BI: Adv Professional Business Author Bundle - (COGNOS-AB5)Services Fees Professional ServicesInstallation - $1400 $ 16,440.00 N/A Project Management - $640 Training - (BICOREMDS) - 40 - $9000 Cognos BI Training Services - (COGNOS-TRAIN-INT) - $5400 Existing ProductsGMBA w/Extended Reporting (ER), Accounts Receivable (MR), Asset N/A Included in (Currently Licensed)Management (FA), Payroll/Personnel (PR), Purchasing/Inventory (PI), Monthly Fee Procurement Card Tracking (PC), Human Resources (HR), Cash Receipts (CR), Work Orders/Facility Management (WF), Fleet Management (FM), Land Management (LX), Building Permits (BP), Code Enforcement (CE), Occupational Licenses (OL), Planning/Engineering (PZ), Customer Information System (CX), Click2Gov Core Module Embedded (K1), Click2Gov Occupational Licenses (K6), Click2Gov CIS (K2), OnePoint Core (KL), One Point C2G Credit Card Payment Activation, Document Management Services (DX), Additional PR Library, Additional DMS License (1), Cash Receipts Lockbox (CA), Rec Trac I/F to GMBA (VG), RecTrac for Cash Receipts (VI), B/P Voice Response Interface (Teleworks)(V1) Third Party Products Hosting WorksRight Software.N/A Included in Monthly Fee Retrofit Maintenance Retrofit Modification (16)N/A Included in Monthly Fee Hardware AllocationVPN Concentrator Option to include management and configuration N/A Included in VPN tunnel, Click2Gov Hardware and software will be hosted and Monthly Fee managed by SunGard Public Sector. ServicesSetup, Implementation, ASP Helpcard SP1, Disaster Recovery Plan N/A Included in for SunGard Public Sector applicationsMonthly Fee Removal of Third Party Cognos Admin (2) CG, Cognos End User (20) CG, QREP Catalogs N/A $ (930.00) Products/Existing Products(GM, BP, PR, FA, PI, CR, LX, PZ, OL, CX, HR, WF, PC, FM, CE)- CJ Total Proposed System: $ 16,440.00 $ 16,406.98 APPLICABLE TAXES ARE NOT INCLUDED IN THIS SCHEDULE, AND, IF APPLICABLE, WILL BE ADDED TO THE AMOUNT IN THE PAYMENT INVOICE(S) BEING SENT SEPARATELY TO THE CUSTOMER. 7YR+EVH4YFPMG7IGXSV%74%KVIIQIRX Page 589 of 804 Page 1 of 3 6IZ  DocuSign Envelope ID: 21A25245-EF97-4F4D-9C4D-5B229A95D2A4  3. Payment Terms: Installation Fees: Due on invoice, upon completion. Project Management Fees: 100% Due upon execution. Training Fees: On invoice as incurred. Third Party Products Services Fee: 50% on the Execution Date; 50% on invoice, upon completion. Monthly Access Fee: The initial Monthly Access Fee will be due January 1, 2015. Subsequent Monthly Access Fees will be due on the first of the month thereafter. Monthly Access Fees will be invoiced in advance on a monthly basis for a term of sixty (60) months at the rates listed below. Months 1 12 $ 16,406.98 per month or $196,883.71 per year; Months 13 24 $ 16,571.05 per month or $198,852.55 per year; Months 25 36 $ 16,736.76 per month or $200,841.08 per year; Months 37 48 $ 16,904.12 per month or $202,849.49 per year; Months 49 60 $ 17,073.17 per month or $204,877.98 per year Following the initial term, Services will be provided on a year-to-year basis provided the Customer exercises the option and pays the then current Monthly Access Fee. Travel and Living Expenses: Travel and living expenses are in addition to the prices quoted above and will be invoiced as incurred and shall be governed by the SunGard Public Sector Corporate Travel and Expense Reimbursement Policy. Travel and living expenses actually incurred in prior months for which SunGard Public Sector is seeking reimbursement, shall also be invoiced monthly. Notes: 1 Monthly Access Fees listed above are for the Applications and Services listed in this Schedule A- Order Form only. 2 Following the execution of this Schedule A-Order Form, any new Modification Retrofits provided by SunGard Public Sector will be added to the next annual renewal period, pursuant to Section 4 below. 4. Modification Retrofits. For each non-standard Application in library HTEMOD that was written by SunGard Public Sector or any Application that has had custom modifications performed by SunGard Public Sector SunGard Public Sector will perform all necessary programming to ensure that the program is compatible with each new software release, version, or program temporary fix made available by SunGard Public Sector. Fees for Modification Retrofits to be maintained are determined on an annual basis. This determination is based upon the number of modified objects prior to the beginning of each annualized ASP Term multiplied by the then current rate charged per object.    7YR+EVH4YFPMG7IGXSV%74%KVIIQIRX Page 590 of 804 Page 2 of 3 6IZ  DocuSign Envelope ID: 21A25245-EF97-4F4D-9C4D-5B229A95D2A4  5. Third Party Software and Hardware. Unless otherwise provided for herein, warranty, modification retrofit and maintenance offerings by SunGard Public Sector for its Licensed Program(s) do not apply to any third party hardware or third party software supplied under this Supplement. SunGard Public Sector does not make any warranties nor provide any source code for any non-SunGard Public Sector products unless otherwise provided herein. The return and refund policy of each individual third party hardware or third party software supplier shall prevail unless otherwise provided herein.    City of Boynton Beach, FLSunGard Public Sector BY: BY: PRINTED NAME: PRINTED NAME: Lisa Neumann PRINTED TITLE: PRINTED TITLE: Controller DATE SIGNED: DATE SIGNED: October 24, 2014 7YR+EVH4YFPMG7IGXSV%74%KVIIQIRX Page 591 of 804 Page 3 of 3 6IZ  Page 592 of 804 Page 593 of 804 Page 594 of 804 Page 595 of 804 Page 596 of 804 Page 597 of 804 Page 598 of 804 Page 599 of 804 Page 600 of 804 Page 601 of 804 Page 602 of 804 Page 603 of 804 Page 604 of 804 Page 605 of 804 Page 606 of 804 Page 607 of 804 Page 608 of 804 Page 609 of 804 Page 610 of 804 Page 611 of 804 Page 612 of 804 Page 613 of 804 Page 614 of 804 RFP FOR BUILDING DIVISION SERVICES "Offers from the vendors listed herein are the only offers RFP DUE DATE: SEPTEMBER 25, 2014 received timely as of the above receiving date and time. RFP DUE TIME: 2:30 P.M. All other offers submitted in response to this solicitation, RFP No.: 076-2411-14/JMA if any, are hereby rejected as late" VENDORS '%0:-2+-36(%23 %773'-%8)7'%4+3:)621)28-2'18'%970)=-2' )PPIV(VMZI7YMXI1IVMHMER4O[]7YMXI2)7XVIIX *SVX0EYHIVHEPI*0;IWXSR*0,SQIWXIEH*0 8IP  8IP  8IP   )QEMPWIMGLRIV$GKEWSPYXMSRWGSQ)QEMPGETIRMR$GETJPEGSQ)QEMP1MOI$QXGMRWTIGXSVWGSQ 'SRXEGX7LIPPI])MGLRIV'SRXEGX'EVPSW%4IRMR'SRXEGX1MGLEIP8'EYWPI] ONE ORIGINAL AND THREE COPIESYESYESYES SUBMITTED TABLE OF CONTENTSYESYESYES SUBMITTED QUALIFICATIONS AND EXPERIENCEYESYESYES OF THE FIRM SUBMITTED KEY PERSONNELYESYESYES SUBMITTED TRANSITION PLAN YESYESYES SUBMITTED REFERENCES SUBMITTEDYESYESYES FEES ANNUAL COSTANNUAL COSTANNUAL COST $180,000.00$124,800.00$162,240.00 ()498=&9-0(-2+3**-'-%0 $146,250.00$371,800.00$146,600.00 7-2+0)(-7'-40-2)*-)0(-274)'836 (for three inspectors) $146,250.00$101,400.00$156,000.00 1908-(-7'-40-2)*-)0(-274)'836 $168,750.00$273,000.00$156,000.00 7-2+0)(-7'-40-2)40%27)<%1-2)6 (for two examiners) $168,750.00$117,000.00$156,000.00 1908-(-7'-40-2)40%27)<%1-2)6 $146,250.00$93,600.00$124,800.00 &97-2)77-274)'836 TOTAL ANNUAL COST $956,250.00$1,081,600.00$901,640.00 Page 615 of 804 SHEET 1RFP FOR BUILDING DIVISION SERVICES RFP FOR BUILDING DIVISION SERVICES "Offers from the vendors listed herein are the only offers RFP DUE DATE: SEPTEMBER 25, 2014 received timely as of the above receiving date and time. RFP DUE TIME: 2:30 P.M. All other offers submitted in response to this solicitation, RFP No.: 076-2411-14/JMA if any, are hereby rejected as late" VENDORS '%0:-2+-36(%23 %773'-%8)7'%4+3:)621)28-2'18'%970)=-2' )PPIV(VMZI7YMXI1IVMHMER4O[]7YMXI2)7XVIIX *SVX0EYHIVHEPI*0;IWXSR*0,SQIWXIEH*0 8IP  8IP  8IP   )QEMPWIMGLRIV$GKEWSPYXMSRWGSQ)QEMPGETIRMR$GETJPEGSQ)QEMP1MOI$QXGMRWTIGXSVWGSQ 'SRXEGX7LIPPI])MGLRIV'SRXEGX'EVPSW%4IRMR'SRXEGX1MGLEIP8'EYWPI] PROPOSER'S ACKNOWLEDGEMENTYESYESYES SUBMITTED ACKNOWLEDGEMENT OF YESYESYES ADDENDA SUBMITTED STATEMENT OF PROPOSER'SYESYESYES QUALIFICATIONS SUBMITTED ANTI-KICKBACK AFFIDAVITYESYESYES SUBMITTED NON COLLUSION AFFIDAVITYESYESYES SUBMITTED CONFIRMATION OF MINORITY YES/NOT A MINORITYYES/HISPANIC OWNEDYES/NOT A MINORITY OWNED BUSINESSOWNED BUSINESSBUSINESS - NOT CERTIFIEDOWNED BUSINESS CONFIRMATION OF DRUG FREEYESYESYES WORKPLACE ACKNOWLEDGEMENT OF PBC YESYESYES INSPECTOR GENERAL SCHEDULE OF SUBCONTRACTORSYES/NONEYES/NONEYES/NONE SUBMITTED CURRENT LICENSESYESYESYES SUBMITTED CERTIFICATE OF INSURANCEYESYESYES SUBMITTED COMMENTS: Page 616 of 804 SHEET 1RFP FOR BUILDING DIVISION SERVICES RFP FOR BUILDING DIVISION SERVICES "Offers from the vendors listed herein are the only offers RFP DUE DATE: SEPTEMBER 25, 2014 received timely as of the above receiving date and time. RFP DUE TIME: 2:30 P.M. All other offers submitted in response to this solicitation, RFP No.: 076-2411-14/JMA if any, are hereby rejected as late" VENDORS ,=&=6(-2'2:-2' 7SYXL)EWX'SEWX7XVIIX7SYXL4EVO6SEH7YMXI 0EOI;SVXL*0,SPP][SSH*0 8IP  8IP   )QEMPL]F]VH$FIPPWSYXLRIX)QEMP'EVPSW4IVHSQS$RZGSQ 'SRXEGX1MGLEIP'VMWEJYPPI'SRXEGX'EVPSW4IVHSQS ONE ORIGINAL AND THREE COPIESYESYES SUBMITTED TABLE OF CONTENTSYESYES SUBMITTED QUALIFICATIONS AND EXPERIENCEYESYES OF THE FIRM SUBMITTED KEY PERSONNELYESYES SUBMITTED TRANSITION PLAN YESYES SUBMITTED REFERENCES SUBMITTEDYESYES FEES ANNUAL COSTANNUAL COSTANNUAL COST $124,800.00$176,800.00 ()498=&9-0(-2+3**-'-%0 $110,240.00$135,200.00 7-2+0)(-7'-40-2)*-)0(-274)'836 $120,640.00$145,600.00 1908-(-7'-40-2)*-)0(-274)'836 $106,080.00$156,000.00 7-2+0)(-7'-40-2)40%27)<%1-2)6 $118,560.00$166,400.00 1908-(-7'-40-2)40%27)<%1-2)6 $95,680.00$156,000.00 &97-2)77-274)'836 TOTAL ANNUAL COST $676,000.00$936,000.00 Page 617 of 804 SHEET 2RFP FOR BUILDING DIVISION SERVICES RFP FOR BUILDING DIVISION SERVICES "Offers from the vendors listed herein are the only offers RFP DUE DATE: SEPTEMBER 25, 2014 received timely as of the above receiving date and time. RFP DUE TIME: 2:30 P.M. All other offers submitted in response to this solicitation, RFP No.: 076-2411-14/JMA if any, are hereby rejected as late" VENDORS ,=&=6(-2'2:-2' 7SYXL)EWX'SEWX7XVIIX7SYXL4EVO6SEH7YMXI 0EOI;SVXL*0,SPP][SSH*0 8IP  8IP   )QEMPL]F]VH$FIPPWSYXLRIX)QEMP'EVPSW4IVHSQS$RZGSQ 'SRXEGX1MGLEIP'VMWEJYPPI'SRXEGX'EVPSW4IVHSQS PROPOSER'S ACKNOWLEDGEMENTYESYES SUBMITTED ACKNOWLEDGEMENT OF YESYES ADDENDA SUBMITTED STATEMENT OF PROPOSER'SYESYES QUALIFICATIONS SUBMITTED ANTI-KICKBACK AFFIDAVITYESYES SUBMITTED NON COLLUSION AFFIDAVITYESYES SUBMITTED CONFIRMATION OF MINORITY YES/NOT A MINORITYYES/NOT A MINORITY OWNED BUSINESSOWNED BUSINESSOWNED BUSINESS CONFIRMATION OF DRUG FREEYESYES WORKPLACE ACKNOWLEDGEMENT OF PBC YESYES INSPECTOR GENERAL SCHEDULE OF SUBCONTRACTORSYES/FOURYES/NONE SUBMITTED CURRENT LICENSESYESYES SUBMITTED CERTIFICATE OF INSURANCEYESYES SUBMITTED COMMENTS: Page 618 of 804 SHEET 2RFP FOR BUILDING DIVISION SERVICES RFP FOR "BUILDING DIVISION SERVICES" RFP No.: 076-2411-14/JMA SUMMARY OF REVIEWERS SCORES QUALIFICATIONSKEYTRANSITIONREFERENCESPROPOSEDTOTALS OF FIRMPERSONNELPLANFEES NAME: CALVIN, GIORDAN O 25.0020.005.0010.0020.0080.00 N. BYRNE 23.0015.0010.0015.0017.0080.00 J. LIVERGOOD 25.0020.0010.0015.0016.0086.00 A. MACK 246.00 TOTAL C.A.P. GOVERNMENT 25.0020.0010.0010.0028.0093.00 N. BYRNE 16.0016.007.0015.0025.0079.00 J. LIVERGOOD 25.0020.008.0015.0022.0090.00 A. MACK 262.00 TOTAL M.T. CAUSLEY 15.0010.0010.0015.0025.0075.00 N. BYRNE 24.0018.008.0015.0019.0084.00 J. LIVERGOOD 25.0020.005.0015.0017.0082.00 A. MACK 241.00 TOTAL HY-BYRD 10.005.002.005.0030.0052.00 N. BYRNE 18.0017.003.0015.0028.0081.00 J. LIVERGOOD 25.0020.005.0015.0030.0095.00 A. MACK 228.0 0 TOTAL NV5, INC. 15.0015.007.005.0023.0065.00 N. BYRNE 23.0017.007.008.0021.0076.00 J. LIVERGOOD 20.0020.007.0013.0016.0076.00 A. MACK 241.00 TOTAL Page 619 of 804 Page 620 of 804 Page 621 of 804 Page 622 of 804 Page 623 of 804 Page 624 of 804 Page 625 of 804 Page 626 of 804 Page 627 of 804 Page 628 of 804 Page 629 of 804 Page 630 of 804 Page 631 of 804 Page 632 of 804 Page 633 of 804 Page 634 of 804 Page 635 of 804 Page 636 of 804 Page 637 of 804 Page 638 of 804 Page 639 of 804 Page 640 of 804 Page 641 of 804 Page 642 of 804 Page 643 of 804 Page 644 of 804 Page 645 of 804 Page 646 of 804 Page 647 of 804 Page 648 of 804 Page 649 of 804 Page 650 of 804 Page 651 of 804 Page 652 of 804 Page 653 of 804 Page 654 of 804 Page 655 of 804 Page 656 of 804 Page 657 of 804 Page 658 of 804 Page 659 of 804 Page 660 of 804 Page 661 of 804 Page 662 of 804 Page 663 of 804 Page 664 of 804 Page 665 of 804 Page 666 of 804 Page 667 of 804 Page 668 of 804 Page 669 of 804 Page 670 of 804 Page 671 of 804 Page 672 of 804 Page 673 of 804 Page 674 of 804 Page 675 of 804 Page 676 of 804 Page 677 of 804 Page 678 of 804 Page 679 of 804 Page 680 of 804 Page 681 of 804 Page 682 of 804 Page 683 of 804 Page 684 of 804 Exhibit ā€˜A’ Location Map: Portion of Lake Drive Page 685 of 804 Exhibit ā€˜C’ Page 686 of 804 Page 687 of 804 Page 688 of 804 Page 689 of 804 Page 690 of 804 Page 691 of 804 Page 692 of 804 Page 693 of 804 Page 694 of 804 Page 695 of 804 Page 696 of 804 Page 697 of 804 Page 698 of 804 Page 699 of 804 Page 700 of 804 Page 701 of 804 Page 702 of 804 Page 703 of 804 Page 704 of 804 Page 705 of 804 Page 706 of 804 Page 707 of 804 Page 708 of 804 Page 709 of 804 Page 710 of 804 Page 711 of 804 Page 712 of 804 Page 713 of 804 Page 714 of 804 Page 715 of 804 Page 716 of 804 Page 717 of 804 Page 718 of 804 Page 719 of 804 Page 720 of 804 Page 721 of 804 Page 722 of 804 Page 723 of 804 Page 724 of 804 Page 725 of 804 Page 726 of 804 Page 727 of 804 Page 728 of 804 Page 729 of 804 Page 730 of 804 Page 731 of 804 Page 732 of 804 Page 733 of 804 Page 734 of 804 Page 735 of 804 Page 736 of 804 Page 737 of 804 Page 738 of 804 Page 739 of 804 Page 740 of 804 Page 741 of 804 Page 742 of 804 Page 743 of 804 EXHIBIT "A" CASA DEL MAR SITE LOCATION MAP PROJECT SITE ¯ 140700140 Feet Page 744 of 804 Page 745 of 804 Page 746 of 804 Page 747 of 804 Page 748 of 804 Page 749 of 804 Page 750 of 804 Page 751 of 804 Page 752 of 804 Page 753 of 804 Page 754 of 804 Page 755 of 804 Page 756 of 804 Page 757 of 804 Page 758 of 804 Page 759 of 804 Page 760 of 804 Page 761 of 804 Page 762 of 804 Page 763 of 804 Page 764 of 804 Page 765 of 804 Page 766 of 804 Page 767 of 804 Page 768 of 804 H.O.A. NOTE BUILDING 5 AREA CALCULATIONSBUILDING 6 AREA CALCULATIONS Y RA THE ESTABLISHED HOMEOWNERS ASSOCIATION WILL NOT D ESIGN ALLOW INDIVIDUAL POOLS OR ADDITIONS, AND WILL NOT ALLOW 5 UNITS, 4 STORY BUILDING5 UNITS, 4/3 STORY BUILDING (1 X 4 STORY UNIT A1END, PATIOS, PORCHES, OR BALCONIES TO BE MODIFIED (I.E. I NC. INCREASED IN SIZE, ENCLOSED OR SCREENED. (2 X UNIT A1END, 2 X UNIT A, 1 X UNIT A1) 1 X 3 STORY UNIT A1 END, 2 X UNIT A, 1 X UNIT A1) TOTAL U/A OF UNITS A AND A1TOTAL U/A OF UNITS A AND A1 2,852 S.F. X 3 8,556 S.F.2,852 S.F. X 3 8,556 S.F. %% 7398,(-<-),-+,;%=79-8) TOTAL U/A OF UNIT A1ENDTOTAL U/A OF UNIT A1END 4 STORY ;)784%01&)%',*0 5,792 S.F.2,896 S.F. 2,896 S.F. X 2 2,896 S.F. X 1 LEGEND 8)0*%< TOTAL U/A OF UNIT A1END 3 STORY ;)&7-8)[[[]VEHIWMKRGSQ TOTAL U/A OF BUILDING14,348 S.F. 2,316 S.F. X 1 2,316 S.F. MASONRY CONSTRUCTION)1%-0]VE$]VEMRGGSQ TOTAL GARAGES (408 S.F. X 5) 2,040 S.F. BATT INSULATION (SEE FLOOR PLAN)13,768 S.F. TOTAL U/A OF BUILDING TOTAL AREA OF BUILDING16,388 S.F. SOUND BATTS (SEE FLOOR PLAN) TOTAL GARAGES (408 S.F. X 5) 2,040 S.F. COVERED ENTRIES102 S.F. CLOSED CELL FOAM INSULATION 15,808 S.F. TOTAL AREA OF BUILDING (SEE FLOOR PLAN)COVERED PATIOS 1ST FLR720 S.F. NON-BEARING FRAMED COVERED ENTRIES101 S.F. COVERED BALCONIES 2ND FLR724 S.F. CONSTRUCTION NON-BEARING FRAMED COVERED PATIOS 1ST FLR722 S.F. 285 S.F. COVERED BALCONIES 3RD FLR CONSTRUCTION WALL ABOVE OR HIDDEN COVERED BALCONIES 2ND FLR724 S.F. COVERED BALCONIES 4th FLR661 S.F. BEARING FRAME CONSTRUCTION COVERED BALCONIES 3RD FLR287 S.F. TOTAL COVERED AREA18,880 S.F. COVERED BALCONIES 4th FLR527 S.F. SOFFIT AS NOTED ON PLAN OPEN BALCONIES 4TH FLOOR1,476 S.F. 18,169 S.F. TOTAL COVERED AREA FRONT BALCONIES97 S.F. /,SZRERMER'SQTERMIW00' OPEN BALCONIES 4TH FLOOR1,178 S.F. TOTAL AREA OF BUILDING20,453 S.F.;IWX*VSRX7XVIIX FRONT BALCONIES97 S.F. 6IH&ERO2. XIP TOTAL AREA OF BUILDING19,444 S.F. date: approved: 120'-8" job no: 24'-0"24'-0"24'-0" 24'-4" 24'-4" revisions: Covered PatioCovered PatioCovered PatioCovered PatioCovered Patio OptOpt OptOptOpt PwdrPwdr PwdrPwdrPwdr BonusBonus BonusBonusBonus Family RmFamily Rm Family RmFamily RmFamily Rm Stor.Stor.Stor.Stor. MechMech MechMechMech UPUPUP UPUP site resubmital 10/7/2014 UPUPUP UPUP FoyerFoyerFoyerFoyerFoyer 2 Car Garage2 Car Garage2 Car Garage2 Car Garage 2 Car Garage SEAL 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT AUNIT A-1UNIT A-1 END sheet no. 15 ofshts Page 769 of 804 TYPICAL STAIR NOTESTYPICAL RAILING NOTESLEGEND Y RA 1. GUARDRAILS: 2. HANDRAILS: MASONRY CONSTRUCTION 3 1.RISER HEIGHT SHALL NOT EXCEED 7" PER FBC 2010 LOADING OF DISTRIBUTED LIVE LOADS AS FOLLOWS: 1 PORCHES, BALCONIES, OR RAISED FLOOR SURFACES D 4 ALL REQUIRED HANDRAILS SHALL BE ONE OF THEB) TYPE II. HANDRAILS WITH A PERIMETER GREATER THAN 6" SHALL ESIGN 4 BATT INSULATION R311.7.4.1. LOCATED MORE THAN 30" ABOVE THE FLOOR OR GRADE FOLLOWING TYPES OR PROVIDE EQUIVALENTPROVIDE A GRASPABLE FINGER RECESS AREA ON BOTH SIDES OFGUARDRAILS & HANDRAILS: 200 LBS * (SEE FLOOR PLAN) SHALL HAVE GUARDS NOT LESS THAN 42" IN HEIGHT. THE PROFILE. THE FINGER RECESS SHALL BEGIN WITHIN A DISTANCE GRASPABILITY.GUARDRAILS IN-FILL COMPONENTS:50 LBS I LANDINGS AT STAIRWAYS SHALL CONFORM TO FBC 2010** 2. NC. OPEN SIDES OF STAIRS WITH A TOTAL RISE OF MORE THAN SOUND BATTS (SEE FLOOR PLAN) 3 R311.7.5. VERTICAL RISE SHALL NOT EXCEED 12 FEET BETWEENOF " MEASURED VERTICALLY FROM THE TALLEST PORTION OF THE A) TYPE I. HANDRAILS WITH A CIRCULAR CROSS SECTION 4 30" ABOVE THE FLOOR OR GRADE BELOW SHALL HAVE FLOOR LEVELS OR LANDINGS. 57 PROFILE AND ACHIEVE A DEPTH OF AT LEAST " WITHIN " BELOW THE 1 SHALL HAVE AN OUTSIDE DIAMETER OF AT LEAST 1" AND*A SINGLE CONCENTRATED LOAD APPLIED IN ANY DIRECTION ATCLOSED CELL FOAM INSULATION 168 GUARDS NOT LESS THAN 34" IN HEIGHT MEASURED 4 WIDEST PORTION OF THE PROFILE. THIS REQUIRED DEPTH SHALL(SEE FLOOR PLAN) NOT GREATER THAN 2". IF THE HANDRAIL IS NOT CIRCULAR ANY POINT ALONG THE TOP. 3.TREAD DEPTH SHALL BE AT LEAST 10" PER FBC 2010VERTICALLY FROM THE NOSING OF THE TREADS. PORCHES 33 IT SHALL HAVE A PERIMETER DIMENSION OF AT LEAST 4" ANDCONTINUE FOR AT LEAST " TO A LEVEL THAT IS NOT LESS THAN 1" NON-BEARING FRAMED R311.7.4.2AND DECKS WHICH ARE ENCLOSED WITH INSECTGUARD IN-FILL COMPONENTS (ALL THOSE EXCEPT THE HANDRAIL) , 84** CONSTRUCTION 1 BELOW THE TALLEST PORTION OF THE PROFILE. THE MINIMUM WIDTH NOT GREATER THAN 6" WITH A MAXIMUM CROSS SECTION SCREENING SHALL BE PROVIDED WITH GUARDS WHERE THEBALUSTERS AND PANEL FILLERS SHALL BE DESIGNED TO WITHSTAND %% 4 1 NON-BEARING FRAMED 1 OF THE HANDRAIL ABOVE THE RECESS SHALL BE 1" TO A MAXIMUM WALKING SURFACE IS MORE THAN 30" ABOVE THE FLOORA HORIZONTALLY APPLIED NORMAL LOAD OF 50 POUNDS ON AN DIMENSION OF 2". 4 CONSTRUCTION WALL ABOVE7398,(-<-),-+,;%=79-8) 4 3 OR GRADE BELOW. SHOP DRAWINGS SHALL BE SUBMITTEDAREA EQUAL TO 1 SQUARE FOOT. THIS LOAD NEED NOT BEOR HIDDEN OF 2". EDGES SHALL HAVE A MINIMUM RADIUS OF 0.01". 4 ;)784%01&)%',*0 BY THE BUILDER AS REQUESTED BY THE BUILDINGASSUMED TO ACT CONCURRENTLY WITH ANY OTHER LIVE LOAD DEPARTMENT.8)0*%< REQUIREMENT. BEARING FRAME CONSTRUCTION ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ SOFFIT AS NOTED ON PLAN /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" date: approved: job no: revisions: Covered DeckCovered DeckCovered DeckCovered DeckCovered Deck Great RoomGreat RoomGreat RoomGreat RoomGreat Room DiningDining KitchenKitchenKitchen UPUPUPUPUP DNDNDNDNDN KitchenKitchen site DiningDiningDining resubmital Pwd.Pwd.Pwd.Pwd.Pwd. 10/7/2014 SEAL 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT AUNIT A-1UNIT A-1 END sheet no. 15 ofshts Page 770 of 804 LEGEND Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION (SEE FLOOR PLAN) I NC. SOUND BATTS (SEE FLOOR PLAN) CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) NON-BEARING FRAMED CONSTRUCTION %% NON-BEARING FRAMED CONSTRUCTION WALL ABOVE7398,(-<-),-+,;%=79-8) OR HIDDEN ;)784%01&)%',*0 8)0*%< BEARING FRAME CONSTRUCTION ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ SOFFIT AS NOTED ON PLAN /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" date: 7'-5"7'-5"7'-1"7'-5"7'-5"40'-11"7'-5"7'-1"7'-5"7'-5" 6'-0"3'-6"6'-0"13'-0"51'-6"3'-6"3'-6"6'-0"3'-6"6'-0" approved: job no: revisions: PatioPatioPatioPatioPatio Master Master Master Suite SuiteSuite BathBathBathBathBath Master Master Suite Suite WICWICWICWICWIC DNDNDNDNDN Hall BathHall BathHall BathHall BathHall Bath ClCl LdryLdryLdryLdryLdry ClClCl site Bedroom #3Bedroom #2Bedroom #3Bedroom #2Bedroom #2Bedroom #3Bedroom #2Bedroom #3Bedroom #2Bedroom #3 resubmital 10/7/2014 3'-3"7'-7"3'-6"3'-6"4'-4"2'-2"2'-10"3'-2"3'-8"4'-4"4'-4"3'-8"2'-0"45'-1"2'-0"2'-2"3'-8"4'-4"4'-4"3'-6"3'-6"4'-4"4'-4"3'-8"3'-3"3'-2"2'-10"2'-2"4'-4"3'-6"3'-6"4'-4"3'-3"3'-3" SEAL 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT A-1UNIT AUNIT A-1 END sheet no. 15 ofshts Page 771 of 804 120'-8" LEGEND 24'-0"24'-0"24'-0"24'-4" 24'-4" Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION (SEE FLOOR PLAN) I NC. SOUND BATTS (SEE FLOOR PLAN) CLOSED CELL FOAM INSULATION Open BalconyOpen BalconyOpen BalconyOpen Balcony (SEE FLOOR PLAN) NON-BEARING FRAMED CONSTRUCTION %% NON-BEARING FRAMED TrellisTrellisTrellisTrellis CONSTRUCTION WALL ABOVE7398,(-<-),-+,;%=79-8) OR HIDDEN ;)784%01&)%',*0 8)0*%< BEARING FRAME CONSTRUCTION ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ SOFFIT AS NOTED ON PLAN Covered PatioCovered PatioCovered PatioCovered Patio /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. DNDNDNDN XIP LoftLoftLoftLoft BathBathBathBath date: A/CA/CA/C approved: job no: revisions: 24'-4" 24'-0" 24'-4"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT A-1 UNIT A3 STORY, UNIT A-1 END 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" Open BalconyOpen BalconyOpen BalconyOpen BalconyOpen Balcony TrellisTrellisTrellisTrellisTrellis site resubmital Covered PatioCovered PatioCovered PatioCovered PatioCovered Patio 10/7/2014 SEAL DNDNDNDNDN LoftLoftLoftLoftLoft BathBathBathBathBath A/CA/CA/CA/CA/C sheet no. 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT AUNIT A-1 END UNIT A-1 15 ofshts Page 772 of 804 LEGEND UNIT A1AREA CALCS. Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION 4 STORY (SEE FLOOR PLAN) I NC. PER UNIT SOUND BATTS (SEE FLOOR PLAN) GROUND FLR U/A484 S.F. CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) SECOND FLR U/A844 S.F. NON-BEARING FRAMED CONSTRUCTION THIRD FLR U/A943 S.F. %% NON-BEARING FRAMED FOURTH FLR U/A581 S.F. CONSTRUCTION WALL ABOVE7398,(-<-),-+,;%=79-8) OR HIDDEN ;)784%01&)%',*0 TOTAL U/A2,852 S.F. 8)0*%< BEARING FRAME CONSTRUCTION ;)&7-8)[[[]VEHIWMKRGSQ 408 S.F. 2 CAR GARAGE )1%-0]VE$]VEMRGGSQ SOFFIT AS NOTED ON PLAN OPTIONAL TOTAL AREA PER UNIT3,260 S.F. DUMB- WAITER. COVERED ENTRY20 S.F. 2'-8" COVERED PATIO 1ST FLR144 S.F. 4'-7"4'-7" COVERED BALCONY 2ND FLR144 S.F. COVERED BALCONY 3RD FLR57 S.F. COVERED BALCONY 4TH FLR131 S.F. SHOWER TOTAL COVERED AREA3,756 S.F. 2'-9" Stor. 294 S.F. OPEN BALCONY 4TH FLOOR FRONT BALCONIES19 S.F. Bath TOTAL AREA OF UNIT4,069 S.F. 9'-2" FLAT CLG. /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 11'-10"11'-6" 6IH&ERO2. LAV. LAV. XIP 2'-4" OPTIONAL DUMB W.C. WAITER. date: approved: job no: 24'-0" revisions: 42" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON 42" MTL RAILING W/42" HIGH ALUMINUM FENCE42" HIGH ALUMINUM FENCE SHEET A-2.1 24'-0"24'-0" VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE 6'-9"7'-5"6'-0"3'-2"7'-2"4'-6"4'-10"6'-10" 4"4"4"4"4"4"4"4" TYPICAL RAILING NOTES ON SHEET A-2.1 LINE OF BALCONY ABOVE 1'-4" 1'-4"1'-4"1'-4" 4'-7"10'-10"4'-7" 4"7'-2"9'-2"7'-0"4" 4"4" Patio Covered Patio 4"Covered Deck Master Suite Opt SHOWER 9'-2" FLAT CLG. Pwdr BATH TUB 22'-8" F.F.L. 4" 4"3'-0"6'-3" 11-4" F.F.L. 9'-4" FLAT CLG. Bath W.C. 23'-4" 19'-10"4"3'-2" 9'-2" FLAT CLG. Great 4" 13'-5"6'-0"4"3'-3" Bonus Room Family Rm Stor LAV. LAV. 9'-4" FLAT CLG. 0'-0" REF SLAB 9'-4" FLAT CLG. (SEE CIVIL DWGS) OPTIONAL CABINETS 4"6'-0" A.H.U 4" 8" W.C. 4'-3"4'-2"12'-6"2'-1" AC CHASE RAILING Mech WIC UPUPUP 9'-2" FLAT CLG. site 18R18R 18R E.W.H. Dining Room Stor. resubmital DNDN ELEC. PANEL (V.L.O.J) 9'-4" FLAT CLG. 18R18R LAV. 10/7/2014 W.C. 60 GAL. ELEC. WATER HEATER Hall Bath 4'-0" 8"19'-7" 3'-5"4"5'-0"8'-6"2'-1"3'-5"4" 9'-2" FLAT CLG. FOR OPTIONAL FOR OPTIONALWOOD OPTIONAL DUMB WAITER. Cl Ldry DUMBWAITER. SEEVENEER FACE FAMILY SEE PLAN ABOVE PLAN ABOVE CENTER LOW WALL SEAL @ 42" A.F.F. 2'-6" DW DBL SINK 3'-10" COUNTER CL. W/ DISP. TOP @ 36" A.F.F. LINE OF OVERHEAD DOOR LINE OF UP CABS. 18R ABOVE 4" 18'-0" 4" 5'-0" 2'-1"3'-10"4" Foyer Bedroom #3Bedroom #2 Kitchen 2 Car Garage 9'-2" FLAT CLG.LAV. 9'-2" FLAT CLG. 9'-4" FLAT CLG. 9'-4" FLAT CLG. 24" COUNTER TOP @ 36" 11'-10"4"11'-2"AFF 6" 5'-9"4"1'-11"4"12'-0"2'-6" W.C. LINE OF BUILDING ABOVE sheet no. 36" MTL RAILING W/ Balcony VERTICAL 8" 2'-6"2'-2"1'-8"16'-0"1'-8" BALLUSTRADES 2'-10"3'-4"4'-6"3'-4"3'-4"4'-6"2'-2" (DESIGN T.B.D.) SEE Pwdr. 24'-8" TYPICAL RAILING NOTES 24'-0" 42" MTL RAILING W/ VERTICAL 2'-10"3'-4"4'-6"3'-4"3'-4"4'-6"2'-2" ON SHEET A-2.1 BALLUSTRADES (DESIGN T.B.D.) Rm SEE TYPICAL RAILING NOTES ON 24'-0" SHEET A-2.1 15 ofshts Page 773 of 804 Y RA D ESIGN I NC. %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ 42" MTL RAILING W/ VERTICAL42" MTL RAILING W/ VERTICAL42" MTL RAILING W/ VERTICAL42" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.)BALLUSTRADES (DESIGN T.B.D.)BALLUSTRADES (DESIGN T.B.D.)BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ONSEE TYPICAL RAILING NOTES ONSEE TYPICAL RAILING NOTES ONSEE TYPICAL RAILING NOTES ON SHEET A-2.1SHEET A-2.1SHEET A-2.1SHEET A-2.1 24'-0"24'-0"24'-0"24'-0" 8"8"8"8"8"8"8"8" 23'-4"23'-4"23'-4"23'-4" /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 4'-11"4'-11"1'-4"1'-4"10'-10"10'-10"1'-4"1'-4"4'-11"4'-11"4'-11"4'-11"1'-4"1'-4"10'-10"10'-10"1'-4"1'-4"4'-11"4'-11" 4"4"4"4"4"4"4"4"4"4"4"4"4"4"4"4" 6IH&ERO2. XIP Open PatioOpen PatioOpen PatioOpen Patio 8"8" date: TrellisTrellisTrellisTrellis approved: job no: revisions: Covered PatioCovered PatioCovered PatioCovered Patio 1'-4"1'-4"1'-4"1'-4" 7'-8"7'-8"15'-0"15'-0"7'-8"7'-8"15'-0"15'-0" 33'-10" F.F.L.33'-10" F.F.L. DNDN DNDN LoftLoft 18R18R LoftLoft RAILINGRAILING 9'-2" FLAT CLG.9'-2" FLAT CLG. A/CA/C LAV.LAV. W.C.W.C. 4"4"4"4" 3'-1"3'-1"6'-6"6'-6"13'-1"13'-1" BathBath 13'-6"13'-6" 2'-2"2'-2"5'-7"5'-7" 4"4" 9'-2" FLAT CLG.9'-2" FLAT CLG. 4"4" A/CA/C site resubmital BathBath 10/7/2014 8"8" 6'-1"6'-1" 4"4"14'-2"14'-2"4"4"8"8"4'-1"4'-1"4"4"18'-11"18'-11" Bedroom #4Bedroom #4 SEAL 4'-0"4'-0"2'-2"2'-2"4'-6"4'-6"3'-4"3'-4"3'-4"3'-4"4'-6"4'-6"2'-6"2'-6"3'-10"3'-10"2'-4"2'-4"3'-6"3'-6"4'-4"4'-4"4'-4"4'-4"3'-6"3'-6"2'-2"2'-2" 24'-0"24'-0"24'-0"24'-0" sheet no. 15 ofshts Page 774 of 804 LEGEND UNIT A1 END AREA CALCS. Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION 3 STORY - BUILDING 6 ONLY (SEE FLOOR PLAN) I NC. PER UNIT SOUND BATTS (SEE FLOOR PLAN) GROUND FLR U/A484 S.F. CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) SECOND FLR U/A863 S.F. NON-BEARING FRAMED CONSTRUCTION THIRD FLR U/A969 S.F. %% NON-BEARING FRAMED CONSTRUCTION WALL ABOVE7398,(-<-),-+,;%=79-8) OR HIDDEN TOTAL U/A2,316 S.F. ;)784%01&)%',*0 2 CAR GARAGE408 S.F. 8)0*%< BEARING FRAME CONSTRUCTION 4'-7"4'-7" ;)&7-8)[[[]VEHIWMKRGSQ TOTAL AREA PER UNIT2,724 S.F. )1%-0]VE$]VEMRGGSQ SOFFIT AS NOTED ON PLAN OPTIONAL COVERED ENTRY20 S.F. DUMB- WAITER 2'-8" SHOWER COVERED PATIO 1ST FLR146 S.F. COVERED BALCONY 2ND FLR146 S.F. 2'-9" COVERED BALCONY 3RD FLR59 S.F. TOTAL COVERED AREA3,095 S.F. Bath FRONT BALCONIES20 S.F. 9'-2" FLAT CLG. TOTAL AREA OF UNIT3,115 S.F. LAV.LAV. /,SZRERMER'SQTERMIW00' 11'-10"11'-6" W.C. ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 2'-8" OPTIONAL DUMB- WAITER date: approved: 24'-4" job no: 42" MTL RAILING W/ VERTICAL revisions: BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 42" HIGH ALUMINUM FENCE42" HIGH ALUMINUM FENCE 24'-0" 24'-4" 4"16'-3"6'-0"7'-5"7'-5"4"4"6'-10"4'-8"4'-8"7'-2"4"4" 4" LINE OF BALCONY ABOVE 16" X16"42" MTL Covered Deck 4"7'-0"9'-2"7'-2"4" 4"4" Patio CMU PIER(DESIGN T.B.D.) 4" Covered Patio MasterSuite Opt 9'-2" FLAT CLG. 11'-4" F.F.L. Pwdr 6'-3"3'-0"22'-8" F.F.L. 4" 9'-4" FLAT CLG. Bath W.C. 23'-4" 3'-2"4"19'-10" 9'-2" FLAT CLG. 4" 3'-3"4"6'-0"13'-5" Bonus Great Family Rm RoomStor LAV.LAV. 0'-0" REF SLAB 9'-4" FLAT CLG. 9'-4" FLAT CLG. (SEE CIVIL DWGS) 4" A.H.U W.C. AC CHASE RAILING Mech WIC UP UPUP 18R18R 18R E.W.H. 8"6'-4" 4"4"2'-1" 2'-0"4'-4"4"site Dining Room Stor. DNDN ELEC. PANEL (V.L.O.J) 18R resubmital 9'-4" FLAT CLG.18R LAV. W.C. 60 GAL. ELEC. WATER HEATER 10/7/2014 OPTIONAL Hall Bath FAMILY CENTER 19'-7"4" 2'-1"8'-6"4'-4"4'-8"3'-5"3'-5" 8" 9'-2" FLAT CLG. WOOD FOR OPTIONAL FOR OPTIONAL VENEER FACE 4" Ldry DUMBWAITERDUMBWAITER Cl SEE PLAN ABOVE SEE PLAN ABOVE LOW WALL @ 42" A.F.F. SEAL 2'-6" DW DBL SINK3'-10" COUNTER W/ DISP. TOP @ 36" A.F.F. Cl LINE OF OVERHEAD DOOR LINE OF UP CABINETS ABOVE 18R 4" 18'-0"5'-0" 4"4" 3'-10"2'-1" Foyer Bedroom #2Bedroom #3 Kitchen 2 Car Garage LAV. 9'-2" FLAT CLG. 9'-2" FLAT CLG. 9'-4" FLAT CLG. Pwdr 9'-4" FLAT CLG. 24" COUNTER TOP @ 36" AFF 11'-2"4"11'-10" 6" 4"5'-9" 2'-6"12'-0"4"W.C. LINE OF BUILDING ABOVE sheet no. Balcony 2'-10" 2'-2"4'-6"3'-4"3'-4"4'-6"3'-3"3'-3"4"1'-10"4'-6"3'-4"3'-4"4'-6"3'-4"2'-6"4"1'-4"16'-0"1'-8"2'-2" 42" MTL RAILING W/ VERTICAL 24'-0"24'-0" 24'-4" BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 36" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 15 ofshts Page 775 of 804 UNIT A1 END AREA CALCS. Y RA D ESIGN 4 STORY I NC. PER UNIT GROUND FLR U/A496 S.F. SECOND FLR U/A852 S.F. THIRD FLR U/A957 S.F. %% FOURTH FLR U/A591 S.F. 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 TOTAL U/A2,896 S.F. 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ 408 S.F. 2 CAR GARAGE )1%-0]VE$]VEMRGGSQ TOTAL AREA PER UNIT3,304 S.F. COVERED ENTRY21 S.F. COVERED PATIO 1ST FLR144 S.F. COVERED BALCONY 2ND FLR146 S.F. COVERED BALCONY 3RD FLR57 S.F. COVERED BALCONY 4TH FLR134 S.F. TOTAL COVERED AREA3,806 S.F. 298 S.F. OPEN BALCONY 4TH FLOOR FRONT BALCONIES20 S.F. TOTAL AREA OF UNIT4,124 S.F. /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 24'-0" 8"8" 42" MTL RAILING W/ VERTICAL 23'-4" 24'-4" BALLUSTRADES (DESIGN T.B.D.) 4'-11"1'-4"10'-10"1'-4"4'-11"4"SEE TYPICAL RAILING NOTES ON 4"4"4" 8"4'-11"1'-4"10'-10"1'-4"4'-3" SHEET A-2.1 date: approved: job no: Open Patio revisions: Open Patio 8" Trellis Trellis Covered Patio Covered Patio 8" 8" 7'-8" 8"15'-0" 1'-4" 7'-8" 15'-0" 6 10' 33'-10" F.F.L. 2 9' DNDN 18R Loft Loft 9'-2" FLAT CLG. A/C LAV. W.C. Bathsite 9'-2" FLAT CLG. 4" 13'-1"4" 6'-6" 13'-6"5'-7" 2'-2" 4" resubmital 4" 10/7/2014 A/C 8" 8"18'-11"4"4'-1" Bath SEAL 6'-1" 4"14'-2"4" Bedroom #4 2'-2"3'-6"4'-4"4'-4"3'-6"2'-4"3'-10" 24'-0" 2'-6"4'-6"3'-4"3'-4"4'-6"2'-2"4'-0" 24'-0" sheet no. 15 ofshts Page 776 of 804 LEGEND UNIT A AREA CALCS. Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION 4 STORY (SEE FLOOR PLAN) I NC. PER UNIT SOUND BATTS (SEE FLOOR PLAN) GROUND FLR U/A484 S.F. CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) SECOND FLR U/A844 S.F. NON-BEARING FRAMED CONSTRUCTION THIRD FLR U/A943 S.F. %% NON-BEARING FRAMED FOURTH FLR U/A581 S.F. CONSTRUCTION WALL ABOVE7398,(-<-),-+,;%=79-8) OR HIDDEN ;)784%01&)%',*0 TOTAL U/A2,852 S.F. 8)0*%< BEARING FRAME CONSTRUCTION ;)&7-8)[[[]VEHIWMKRGSQ 408 S.F. 2 CAR GARAGE )1%-0]VE$]VEMRGGSQ SOFFIT AS NOTED ON PLAN TOTAL AREA PER UNIT3,260 S.F. COVERED ENTRY20 S.F. OPTIONAL COVERED PATIO 1ST FLR144 S.F. DUMB- WAITER 2'-8" COVERED BALCONY 2ND FLR144 S.F. 4'-7"4'-7" COVERED BALCONY 3RD FLR57 S.F. COVERED BALCONY 4TH FLR131 S.F. SHOWER TOTAL COVERED AREA3,756 S.F. 294 S.F. 2'-9"OPEN BALCONY 4TH FLOOR FRONT BALCONIES19 S.F. Bath TOTAL AREA OF UNIT4,096 S.F. /,SZRERMER'SQTERMIW00' 9'-2" FLAT CLG. ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 11'-10"11'-6" LAV. LAV. 2'-8" OPTIONAL DUMBWAITER W.C. date: approved: job no: revisions: 24'-0" 42" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 42" MTL RAILING W/42" HIGH ALUMINUM FENCE42" HIGH ALUMINUM FENCE 24'-0" 24'-0" VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE 3'-2"6'-0"7'-5"6'-9"8"6'-8"4'-8"4'-8"7'-0"4" 4"4"4"4"8"4" TYPICAL RAILING NOTES ON SHEET A-2.1 LINE OF BALCONY ABOVE 1'-4"4'-7"1'-4"10'-10"1'-4"4'-7"1'-4" 4"4"4"4" 7'-0"9'-2"7'-2" Patio Covered Deck Covered Patio 4" Master Suite Opt SHOWER 9'-2" FLAT CLG. Great BATH Pwdr 22'-8" F.F.L. 11'-4" F.F.L. 0'-0" REF SLAB Room 6'-3"3'-0" 4" 9'-4" FLAT CLG.(SEE CIVIL DWGS) Bath 9'-4" FLAT CLG. W.C. 23'-4" 3'-2"19'-10" 4" 9'-2" FLAT CLG. 3'-3"6'-0"4"13'-5" 4" Bonus OPTIONAL Family Rm Stor CABINETS LAV. LAV. 4" 2'-0"3'-9"3'-10"5'-1"4'-2"4'-2" 9'-4" FLAT CLG. AC CHASE 4"A.H.U W.C. Kitchen RAILING Mech 9'-4" FLAT CLG. WIC site UPUPUP 9'-2" FLAT CLG. ISLAND 18R18R E.W.H.18R 4" 4" 2'-0"6'-4"4'-4" RAILING resubmital D.W. Stor. LINE OF DNDN CABINETS 10/7/2014 ELEC. PANEL (V.L.O.J) ABOVE 18R 18R LAV. 60 GAL. ELEC. W.C. WATER HEATER FOR OPTIONAL Hall Bath DUMBWAITER SEE PLAN ABOVE WASH. 4" 19'-7"3'-5" 9'-2" FLAT CLG. LOW WALL FOR OPTIONAL @ 42" A.F.F. WIC 8"4"4" DUMBWAITER SEE 2'-1"4'-0"3'-10"7'-0"2'-5"3'-4"SEAL PLANS ABOVE DRY. 24" COUNTER M.W. TOP @ 36" OPTIONAL AFF FAMILY CENTER WOOD 3'-10" COUNTER VENEER TOP @ 36" A.F.F. FACE CL. LINE OF OVERHEAD DOOR UP 4" 18R 4'-8" 18'-4" 4" 4"3'-11" 2'-0" Dining Foyer Bedroom #2Bedroom #3 Room 2 Car Garage LAV. 9'-2" FLAT CLG. 9'-4" FLAT CLG. 9'-2" FLAT CLG. 9'-4" FLAT CLG. 6" 8" 8"16'-9"4"5'-9" 11'-6"11'-6" 4" W.C. FULL HEIGHT CABINET sheet no. Pwdr. LINE OF BUILDING ABOVE Rm 11" 8'-0"8'-0"2'-2"2'-6" 2'-2"3'-6"4'-4"4'-4"3'-6"3'-8"2'-6" 36" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.)24'-0" 24'-0" 2'-2"3'-6"4'-4"4'-4"3'-6"3'-4"2'-10"SEE TYPICAL RAILING NOTES ON SHEET A-2.1 24'-0" 15 ofshts Page 777 of 804 Y RA D ESIGN I NC. %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ 24'-0" /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 8"8" 42" MTL RAILING W/ VERTICAL 23'-4" 6IH&ERO2. 24'-4" BALLUSTRADES (DESIGN T.B.D.) XIP 4'-11"1'-4"10'-10"1'-4"4'-11"SEE TYPICAL RAILING NOTES ON 4"4"4"4" 8" 4'-11"1'-4"10'-10"1'-4"4'-3" SHEET A-2.1 Open Patio Open Patio date: 8" approved: Trellis Trellis job no: revisions: Covered Patio Covered Patio 8" 8" 8"15'-0"7'-8" 1'-4" 15'-0"7'-8" 6 10' 33'-10" F.F.L. 2 9' DN DN 18R Loft Loft 9'-2" FLAT CLG. A/C LAV. W.C. Bath 9'-2" FLAT CLG. 4" 13'-1"4" 6'-6" 13'-6" 5'-7"2'-2" 4" 4" site A/C resubmital 8" 18'-11"4"4'-1" 8" 10/7/2014 Bath 6'-1" 4"14'-2"4" Bedroom #4 SEAL 2'-2"3'-6"4'-4"4'-4"3'-6"2'-4"3'-10" 24'-0" 2'-6"4'-6"3'-4"3'-4"4'-6"4'-0" 2'-2" 24'-0" sheet no. 15 ofshts Page 778 of 804 Page 779 of 804 Page 780 of 804 Page 781 of 804 Y RA D ESIGN 8 I NC. 12 4TYP. + 42'-10"+ 42'-10" %% T.O.B. T.O.B.24 7398,(-<-),-+,;%=79-8) + 41'-6" + 41'-6" T.O.B. T.O.B. ;)784%01&)%',*0 5 19 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ 4 )1%-0]VE$]VEMRGGSQ 669 23 15 + 32'-6"+ 32'-6" 4TH FLR LEVEL4TH FLR LEVEL 15 9 2 16 9 12 6 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. + 21'-6"+ 21'-6" XIP 3RD FLR LVL 3RD FLR LVL 17 2 2 6 12 16 date: approved: job no: 20 revisions: + 10'-0"+ 10'-0" 2nd FLR LVL. 2nd FLR LVL. 7 2 2 29 ELEC. METER VLOJ (V.L.O.J.)(V.L.O.J.)(V.L.O.J.) COMP.COMP.COMP. A/CA/CA/C + 0'-0" + 0'-0" T.O. SLAB. T.O. SLAB. 12 TYP. 4 + 42'-10"+ 42'-10" T.O.B.T.O.B. + 41'-6" + 41'-6" T.O.B. T.O.B. site + 32'-6"+ 32'-6" KEYED ELEVATION NOTES 4TH FLR LEVEL4TH FLR LEVEL resubmital 1 DECORATIVE WOOD BRACKET (SEE 4/A-4.2) CEMENT PAVERS (TREMRON; HERITAGE COLOR, HERRINGBONE 90 PATTERN) 13 10/7/2014 2 STUCCO FINISH (OLD WORLD KNOCKDOWN) WITH SHERWIN WILLIAMS MONTEREY WHITE DECORATIVE WOOD BRACKET (SEE 5/A-4.2) 14 3CLOPAY EXTERIOR DOORS AND GARAGE DOORS W/ WALNUT FINISH COLOR 15 PIER 1 (SEE 2/A-4.1) 4 DECORATIVE SHUTTERS & AWNINGS PAINTED SHERWIN WILLIAMS BLACK MAGIC COLOR 16PIER 1 (SEE 3/A-4.1) 5 FLAT STUCCO PAINTED SHERWIN WILLIAMS POLISHED MAHOGANY COLOR 17 CAST STONE COLUMN ON PIER 1 (SEE 1/A-4.2)+ 21'-6"+ 21'-6" 3RD FLR LVL SEAL 3RD FLR LVL 6RAILINGS PAINTED SHERWIN WILLIAMS BLACK MAGIC COLOR 18 DECORATIVE WOOD BRACKET (SEE 8/A-4.2) 7 OWENS CORNING STONE CULTURED STONE (CORAL STONE STYLE AND FOSSIL REEF COLOR) 19OUTRIGGER (SEE 6/A-4.2) EAGLE ROOFING ROOF TILE (PONDEROSA STYLE AND SIERRA MADRE COLOR) 8 20DECORATIVE WOOD BRACKET (SEE 9/A-4.2) WINDOWS AND SLIDING GLASS DOORS (BRONZE FRAME) 9 21DECORATIVE WOOD BRACKET (SEE 9/A-4.2) 9 10CAST STONE SILL 22CAST STONE PILASTERS FAUX WOOD HEADER 11 23CAST STONE SILL + 10'-0"+ 10'-0" 12CAST STONE 24WOODEN TRELLIS 2nd FLR LVL. 2nd FLR LVL. NOTE 1. BACK-FLOW PREVENTERS SHALL BE PAINTED TO MATCH sheet no. THE PRINCIPAL STRUCTURE AND SCREENED FROM VIEW. + 0'-0" + 0'-0" 2. EQUIPMENT PLACED ON WALLS OF BUILINGS SHALL BE T.O. SLAB.T.O. SLAB. PAINTED TO MATCH THE BUILDING COLOR. 15 ofshts Page 782 of 804 120'-8" 24'-0"24'-0" 24'-0"24'-4" 24'-4" Y RA D ESIGN I NC. %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ TOP OF CONCRETE BEAM BEARING LEGEND ELEV.SYMBOL + 41'-6" 1 1 + 42'-10" A-6 A-6 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. DNDNDNDN XIP RAKED RIDGE RIDGE FIRE RATED SOFFIT date: + 31'-2" BLDNG. 6 ONLY approved: job no: revisions: + 32'-6" BLDNG. 6 ONLY 24'-4" 24'-0" 24'-4"24'-0"24'-0" 4'-0"4'-0" AREA RESERVED FOR FIRE 120'-8" RETARDANT TREATED WOOD NOTE: NO ROOF PENETRATIONS TO BE SEE (6/A-7.1) TYPICAL FIRE SHEATHING. BUILDING CODE WITHIN 4'-0" OF TENANT SEPARATION. RATED SOFFIT DETAIL SECTION 706.4.1.2 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" site resubmital 10/7/2014 1 1 A-6 A-6 SEAL DNDNDNDNDN RIDGE sheet no. 24'-4" 24'-4"24'-0"24'-0"24'-0" 4'-0"4'-0" AREA RESERVED FOR FIRE 120'-8" RETARDANT TREATED WOOD NOTE: NO ROOF PENETRATIONS TO BE SEE (6/A-7.1) TYPICAL FIRE SHEATHING. BUILDING CODE WITHIN 4'-0" OF TENANT SEPARATION. RATED SOFFIT DETAIL SECTION 706.4.1.2 15 ofshts Page 783 of 804 Page 784 of 804 Page 785 of 804 Page 786 of 804 Page 787 of 804 Page 788 of 804 Page 789 of 804 Page 790 of 804 Page 791 of 804 Page 792 of 804 Page 793 of 804 Page 794 of 804 Page 795 of 804 Page 796 of 804 Page 797 of 804 Page 798 of 804 Page 799 of 804 Page 800 of 804 Page 801 of 804 Page 802 of 804 Page 803 of 804 Page 804 of 804