The URL can be used to link to this page

Agenda 03-02-15 Page 1 of 479 Page 2 of 479 Page 3 of 479 Page 4 of 479 Page 5 of 479 Page 6 of 479 Page 7 of 479 Page 8 of 479 Page 9 of 479 Page 10 of 479 BBPD OYNTONEACH OLICE EPARTMENT OFFICE OF MEDIA RELATIONS 100 East Boynton Beach Blvd. Jeffrey S. Katz Boynton Beach, FL 33425 Chief of Police Phone (561) 742-6191 Fax (561) 742-6185 A CFA Accredited Law Enforcement Agency Stephanie Slater F Public Information Officer ORIMMEDIATE RELEASE SLATERS@BBFL.US Feb. 9, 2015 (561) 436-4806 BBPD hosts 2015 South Florida Police K9 Competition WhenBBPDK9BakotakesthefieldatBoyntonBeachHighSchoolnextmonth,ŚĞ͛ůůhavetorun thefastestandhitthehardesttotakehomeatrophy. HiscompetitionisfierceʹBBPDK9FilipandK9Daxxxareinittowinittoo. Theywilljoinmorethan30lawenforcementofficersandtheirK9partnersfromacrossthe statecompetingforthecovetedtitleoftopdoginthe2015SouthFloridaPoliceK9 Competition. Inadditiontothehardest/fastestcompetition,ƚŚĞǇ͛ůůjumpoverfences,crawlthroughbarrels, climbwallsandapprehendafewfakebadguysduringatimedobstaclecourse. Admissionisfreeforthisevent,whichrunsfrom2p.m.to8p.m.onthefieldofthehighschool at4975ParkRidgeBlvd.Petsarenotallowed. Therewillbetonsofactivitiesforthekids,includingarockclimbingwall,bouncehouse,the SWATƚĞĂŵ͛Ɛinteractiveobstaclecourse,andBoyntonBeachFireZĞƐĐƵĞ͛Ɛsimulatedsmoke maze. Food,drinks,cottoncandyandpopcorn,andcompetitionTshirtswillbeavailableforpurchase. Theopeningceremonybeginsat2p.m.withapresentationofcolorsbytheBoyntonBeach PoliceDepartmentHonorGuard.TaylorMcNevin,daughterofSgt.RichardMcNevin,willsing theNationalAnthem. Page 11 of 479 TherewillthenbeaspecialpresentationmadetoSt.:ŽŚŶ͛ƐCounty^ŚĞƌŝĨĨ͛ƐDeputyFarrah Asheinhonorofherlatepartner,K9Baron,whowasdrownedinthelineofdutywhile apprehendingasuspectwantedforfelonynarcoticsdistributiononOct.7,2014. TheK9teamswilltakethefieldat3p.m.fortheobstacle/criminalapprehensionportionofthe competition.Thehardest/fastestdogcompetitionwillbeginat6p.m.,followedbyanawards presentation. AllproceedsfromtheeventbenefittheBoyntonBeachPoliceDepartmentK9Unit.Formore information,visitwww.sflpolicek9competitionorcallPIOStephanieSlaterat5617426191. Page 12 of 479 Page 13 of 479 Page 14 of 479 Page 15 of 479 Page 16 of 479 Page 17 of 479 Page 18 of 479 Page 19 of 479 -28)62%8-32%0/-2)8-'%68)<,-&-8%2(7=1437-91):)286)4368 8LIJSPPS[MRKPMWXWXLIVIWYPXWXLEXQIEWYVIXLIWYGGIWWSJXLIIZIRX 6IEGLIHXLIKSEPSJERIWXEXXIRHIIWXSXLI[IIOIRHIZIRXTPYWEREHHMXMSREPIWXZMWMXSVWXS &S]RXSR&IEGLJVSQ3GX*IF8SXEPIWX EHYVMRK[IIOIRHIZIRX*VM*IFTQ7EX*IFEQTQERH7YR*IFEQTQ F1YWIYQSJ0MJIWX]PIERH*EWLMSR,MWXSV]XSYVW G/MRIXMG'SRRIGXMSR[SVOWLSTW H'YPXYVEPXSYVMWQXSWIIXLIMGSRMGSYXHSSVOMRIXMGEVX[SVOSRXLI%ZIRYISJXLI%VXW 8LIHVE[XSWIIXLIOMRIXMGEVXGSQFMRIH[MXLXLIIHYGEXMSREPTVIWIRXEXMSRWERHHMWTPE]WTVSZMHI GSRXMRYIHHMEPSKYIERHPIEVRMRKI\TIVMIRGIW 7GLSSPHMWTPE]W E&S]RXSR&IEGL,MKL7GLSSP%GEHIQ]4VSKVEQW F+EPE\]))PIQIRXEV]7GLSSP7SPEV&YXXIVµ];SVOWLST G+7XEV8IIR'SZIVGSQIW%PMZI[MXL7SGMEP-WWYIW H(VI]JSSW7GLSSPSJXLI%VXW/MRIXMGEVX[SVOHMWTPE] I(MKMXEP1IHME%VX'SPPIKI%RMQEXIHKVETLMGWERHETTTVSKVEQW J'IRXVEP'LEVXIV7GLSSP7SPEV8VII4VSNIGX &YWMRIWWHMWTPE]W E&SGE&IEVMRKW LIEHUYEVXIVIHMR&S]RXSR&IEGL &IEVMRKW-RRSZEXMSR'SRXIWX ]IEVGPSGO F,EGO0EF2S&S(TVMRXMRKERH(EJX&SSXL 4VIWIRXEXMSRW ETVIWIRXEXMSRWF]-RXIVREXMSREPERHREXMSREPEVXMWXWEFSYXLMWXSV][LMQWMGEPRI[-RXIVREXMSREPOMRIXMGEVXJSVQW MRXIVEGXMZIIRZMVSRQIRXWRI[XIGLRSPSKMGEPEHZERGIQIRXWMRRSZEXMSR78)%1 ;SVOWLSTW E,SPPERHEVXMWX%PI\ERHVI(ERKXEYKLXEFSYXWSPEVIRIVK]MR7SPEV&YXXIVµ];SVOWLSTWEX+EPE\]) )PIQIRXEV]7GLSSPERHXLI7GLSSPLSYWI'LMPHVIR¬W1YWIYQ F6IWYPXIHMREHMWTPE]SJ(ERGMRK7SPEV&YXXIVµMIWEX7GLSSPLSYWI'LMPHVIR¬W1YWIYQ %IGPIGXMGVERKISJHIQSKVETLMGWXLEXEXXIRHIHXLIIZIRX *IIHFEGOJVSQIZIRXTEVXMGMTERXWEXXIRHIIWGSRGPYHIHXLEXXLIIZIRX E%TTIEPIHXSEPPEKIWERHHIQSKVETLMGW F%XXVEGXIHTISTPIVIKMSREPP]REXMSREPP]ERHMRXIVREXMSREPP] G;EW©8,)ªIZIRXXSZMWMXMR7SYXL*PSVMHE 'SPPIGXSVWERHEVXIRXLYWMEWXWTYVGLEWIHEVX[SVOTMIGIWXSXEPMRK E%VX4EPQ&IEGL F/MRIXMGIZIRX[IIOIRH G3YXHSSVOMRIXMGEVX[SVOTSXIRXMEPTYVGLEWIW 'SRWMHIVMRKEPPSJXLIVIKMSREPIZIRXWXEOMRKTPEGIHYVMRK[IIOIRH/MRIXMG%VXIZIRXVIGIMZIH©XSTSJXLI LSYVªERH©JVSRXTEKIªTSWMXMZIQIHMEGSZIVEKIVIEGLMRKERIWXQMPPMSRZMI[IVWERHVIEHIVW E7YR7IRXMRIP F4EPQ&IEGL4SWX G;48:'LERRIP H;4)''LERRIP I'22-RXIVREXMSREP J'SEWXEP7XEV K4EPQ&IEGL%VXWTETIV L&SGE1EKE^MRI M%VX 'YPXYVEP1EKE^MRI N1YPXMTPIPMWXMRKWERHMQEKIWSRWSGMEPQIHMEW Page 20 of 479 )\XIRWMZIQEVOIXMRKGEQTEMKRJVSQVIKMSREPXSMRXIVREXMSREPMRGPYHMRKXLIWSGMEPQIHMEWVIEGLMRKERIWX ZMI[IVWSJERIGPIGXMGVERKISJHIQSKVETLMGW E7EZIXLIHEXIWGEVHWHMWXVMFYXIH2EXMSREPP]ERHVIKMSREPP]MRWIVXIHMR'SEWXEP7XEVQEKE^MRI F7GYPTXYVI1EKE^MRIEH2SZVIEGLIH-RXIVREXMSREPP] GSPPIGXSVWQYWIYQWKEPPIVMIWERHEVXMWXW G%VX,MZI1EKE^MRIEHERHEVXMGPI*EPP3GX(IGERH;MRXIV.ER1EVQSRXLVIEGLIH ERIWX]IEVSPHWVIKMSREPP] HI2I[WPIXXIVWJVSQ.YRI*IFVIEGLIH I4VIWWVIPIEWIWTVIWWVIPIEWIIZIRXPMWXMRKWWIRXJVSQ.YRI*IF J/MRIXMGTVSKVEQWHMWXVMFYXIHVIKMSREPP]EX%VX4EPQ&IEGLERHHYVMRK[IIOIRHIZIRX K%VX4EPQ&IEGL&SSXLTVIWIRXEXMSRERHWLS[FSSOXSQEVOIX/MRIXMG)ZIRX.ERVIEGLIHERIWX EXXIRHIIW-RXIVREXMSREPP]ERHVIKMSREPP] L&S]RXSR*SVYQEH.ERVIEGLIHVIKMSREPP] M-(MKMXEP&MPPFSEVH2SZERH.ER*IFHIPMZIVIHMQTVIWWMSRW N&ERRIVWERHWXVIIXWMKRW.ER*IFVIEGLIHERIWXZMI[W )ZIRX[IIOIRHEXXIRHERGITSWMXMZIP]MQTEGXIHPSGEPFYWMRIWWGSVTSVEXMSRWERHSVKERM^EXMSRW E'VIEXIHPSGEPNSFWXSMRWXEPPEVX[SVOTVITEVIIZIRXQEVOMRKQEXIVMEPWWIXYTERHFVIEOHS[RIZIRX F0SGEPFYWMRIWWIWGSVTSVEXMSRWERHSVKERM^EXMSRWJIEXYVIHEX*VMHE]*IFXL3TIRMRK2MKLX6IGITXMSR G7TSRWSVFERRIVWXLVSYKLSYXIZIRX H3GIER%ZIRYI&S]RXSR&IEGL&PZHERHWSQI'SRKVIWW%ZIVIWXEYVERXWSZIVGETEGMX] I7IGVIX+EVHIR'EJILSWXIH/%3IZIRXJSVEVXMWXWERHKYIWXW J1EVVMSXX,EQTXSR-RR0SVVEMRIERH-RREX&S]RXSR&IEGL[IVIFSSOIHXSGETEGMX] K3YXSJXS[RZMWMXSVWEVVMZIHIEVP]ERHWXE]IHPEXIV %GGSVHMRKXS&SGE1EKE^MRI ©&S]RXSR&IEGLMWRS[SRISJ7SYXL*PSVMHE¬WMRRSZEXMZILSXWTSXWJSVXLI ZMWYEPEVXWª (YIXSXLMWSRISJEOMRHI\LMFMXERHW]QTSWMYQIZIRX&S]RXSR&IEGLLEWFIGSQIORS[REWXLI -RXIVREXMSREPPIEHIVSJOMRIXMGEV X 8LIIZIRXVIZIRYIWERHFYHKIX %'89%0 /-2)8-'6):)29)7*92(7-2/-2( )<4)27) 'MX]7TSRWSV %ZIRYISJXLI%VXW )UYMX]3RI &SGE&IEVMRKW *PMTWXSRI8IGL &YEPS;MPH;MRKW %;%VGLMXIGXW 1MPPIV0ERH4PERRMRK /%3 -7' 'YPXYVEP'SYRGMPSJ4&' 'SEWXEP7XEV %VX4EPQ&IEGL &S]RXSR'6% +VETLMGW4PYW 8SXEPW %TTVS\MQEXII\TIRWIWJSVIZIRX Page 21 of 479 %GXYEPI\TIRHMXYVIWEVIFIMRKEWWIWWIH Page 22 of 479 Page 23 of 479 Page 24 of 479 Page 25 of 479 Page 26 of 479 Page 27 of 479 Page 28 of 479 Page 29 of 479 Page 30 of 479 Page 31 of 479 Page 32 of 479 Page 33 of 479 Class Code XXXXX Grade: 17 FLSA: N CITY OF BOYNTON BEACH, FLORIDA CLASSIFICATION SPECIFICATION CLASSIFICATION TITLE: SPECIAL PROJECTS COORDINATOR PURPOSE OF CLASSIFICATION The purpose of this classification is to perform responsible and independent administrative work in support of the planning, organizing and implementing of the City Manager’s office programs under general supervision of the City Manager. Areas of assignment include, but are not necessarily limited to, project coordination, data analysis, information preparation, special events coordination, marketing, communication liaison between the public and Commissioners, schedule management, records management, and other related functions. ESSENTIAL FUNCTIONS The following duties and functions, as outlined herein, are intended to be representative of the type of tasks performed within this classification. They are not listed in any order of importance. The omission of specific statements of the duties or functions does not exclude them from the classification if the work is similar, related, or a logical assignment for this classification. Other duties may be required and assigned. Answers telephones; greets customers and visitors, including the media; provides assistance, requested documents and information regarding City and department programs and procedures; refers callers to other staff members as appropriate; and takes messages. Maintains the City Commission’s dynamic schedule; prevents scheduling conflicts; anticipates and resolves conflicts competing with senior executives’ schedules and priorities. Coordinates and implements various special projects. Conducts and reviews special studies in conjunction with a project, and analyzes data and makes recommendations based upon studies. Supports the Communications Manager by writing, establishing and distributing e-news; researching audiences and venues; preparing marketing statistics; coordinating the distribution of advertisement literature; preparing supporting materials for presentations; setting-up and breaking-down events; and coordinating follow-up activities. Provides assistance in developing, posting, and documenting internet presence, to include social media presence. Coordinates the Special Events Permit Program. Works with each applicant applying for a permit. Assists applicant to complete the application. Prepares the necessary paperwork to send to Department Special Event designees for approvals from each department. Monitors and coordinates the process until the permit can be issued. Continually assesses event procedures. Serves as a team member of City-produced and sponsored events. Assists with the promotion, planning, coordinating, and execution of various City-produced and City-sponsored events. Page 1 Created: January 2015 Page 34 of 479 City of Boynton Beach, Florida • Special Projects Coordinator XXXXX Establishes and maintains department databases, automated files, lists, and computer records; enters and updates data in databases, to include confidential information; researches and retrieves data from information systems; queries records and reports; and generates reports, lists and other documents from databases Composes, edits, types and processes letters, forms, correspondence, administrative forms, lists, spreadsheets, work orders, and a variety of reports including operational, program related reports; prepares meeting agendas, information packets, legal notices and other meeting related materials; collects and/or compiles information for inclusion in surveys, reports, charts, forms and other documents; maintains records; and creates mailing lists, forms and other resources to support managerial, clerical, and administrative activities. Prepares folders; maintains files of department correspondence, program records, legal documents, and other documents; photocopies and files documents; distributes materials via email, mail, facsimile and other methods of transport; and requests information from other departments and/or parties as necessary to complete department records/files. Shreds obsolete confidential documents. Performs work in support of all functions within the City Manager’s office, including departmental financial administration, marketing, the special events program, branding, and other related activities. Receives and records citizen complaints; forwards complaints to appropriate department and/or staff for resolution; and tracks complaint resolution. Responds to complaints and questions related to department operations; provides information, researches problems, and initiates problem resolution with customer-first focus. Attends conferences, committee meetings, and interdepartmental meetings relating to public administration and marketing as required; makes speeches or presentations. Compiles or monitors various administrative and statistical data pertaining to the City Manager’s office operations; performs research as needed; makes applicable calculations; analyzes data and identifies trends; prepares or generates reports. Promptly scans documents into records management system, ensuring proper template is used and verifying accurate file maintenance. Prepares and responds to Public Records Requests, including preparation and redaction of files as needed. Performs departmental financial functions including: office procurement, 121 check requests, invoice processing and bill reconciliations. Serves as a member of the PIO Team during EOC activation, maintaining all NIMS computer communication functions and documentations. Maintains calm, efficient demeanor during crisis situations. Serves as a liaison with City private and public partnerships as requested. Examples include neighborhood associations, Chamber of Commerce, CRA, etc. Prepares or completes various forms, reports, correspondence, employment contracts, salary surveys, bid proposals, performance appraisals, organizational reports, monthly reports, budgets, goals/objectives, or other documents. Operates a computer to enter, retrieve, review or modify data; verifies accuracy of entered data and makes corrections; utilizes, in a highly effective and efficient way, word processing, spreadsheet, database, records management, e-mail, and other software programs. Page 2 Created: January 2015 Page 35 of 479 City of Boynton Beach, Florida • Special Projects Coordinator XXXXX Establishes and maintains effective working relationships with City employees, elected officials, the press, the general public, industry professionals, and other government agencies. Attends appropriate workshops and training sessions as requested. Performs moderately complex work under limited supervision and maintains professional discretion in processing matters of a sensitive or confidential nature from both a legal and ethical perspective. MINIMUM QUALIFICATIONS Candidate must meet the requirements in options 1 or 2 listed below: 1) Bachelor degree from an accredited college or university in public administration, business administration, business management, project management, or closely-related field and two (2) years of administrative work experience. Must possess and maintain a valid Florida driver’s license. PREFERRED QUALIFICATIONS 2) Master degree from an accredited college or university in public administration, business administration, business management, project management, or closely-related field and six (6) months of administrative work experience. Must possess and maintain a valid Florida driver’s license. PERFORMANCE APTITUDES Data Utilization : Requires the ability to coordinate, manage, and/or correlate data. Includes exercising judgment in determining time, place and/or sequence of operations, referencing data analyses to determine necessity for revision of organizational components, and in the formulation of operational strategy. Human Interaction : Requires the ability to apply principles of persuasion and/or influence over others. Equipment, Machinery, Tools, and Materials Utilization : Requires the ability to operate, maneuver, and/or control the actions of equipment, machinery, tools, and/or materials used in performing essential functions. Verbal Aptitude : Requires the ability to utilize a wide variety of reference, descriptive, advisory and/or design data and information. Mathematical Aptitude : Requires the ability to perform addition, subtraction, multiplication and division; ability to calculate decimals and percentages; may include ability to perform mathematical operations with fractions; may include ability to compute discount, interest, profit and loss, ratio and proportion; may include ability to calculate surface areas, volumes, weights, and measures. Functional Reasoning : Requires the ability to apply principles of logical or synthesis functions; to deal with several concrete and abstract variables; and to analyze major problems that require complex planning for interrelated activities that can span one or several work units. Situational Reasoning : Requires the ability to exercise judgment, decisiveness, and creativity in situations involving the evaluation of information against sensory, judgmental, or subjective criteria, as opposed to that which is clearly measurable or verifiable. Page 3 Created: January 2015 Page 36 of 479 City of Boynton Beach, Florida • Special Projects Coordinator XXXXX ADA COMPLIANCE Physical Ability : Tasks require the ability to exert light physical effort in sedentary to light work, but which may involve some lifting, carrying, pushing and/or pulling of objects and materials of light weight (15 pounds). Tasks may involve extended periods of time at a keyboard or workstation. Sensory Requirements : Some tasks require the ability to perceive and discriminate visual cues or signals. Some tasks require the ability to communicate orally. Environmental Factors : Essential functions are regularly performed in usual office conditions with rare exposure to adverse environmental conditions. The City of Boynton Beach, Florida, is an Equal Opportunity Employer. In compliance with the Americans with Disabilities Act (42 U.S. C. 12101 et. seq.), the City of Boynton Beach will provide reasonable accommodations to qualified individuals with disabilities and encourages both prospective and current employees to discuss potential accommodations with the employer. The physical demands described are representative of those that must be met by an employee to successfully perform the essential functions of this job. A review of this position has excluded the marginal functions of the position that are incidental to the performance of fundamental job duties. All duties and responsibilities are essential job functions and requirements are subject to possible modifications to reasonably accommodate individuals with disabilities. To perform this job successfully, the incumbent(s) will possess the abilities and aptitudes to perform each duty proficiently. Some requirements may exclude individuals who pose a direct threat of significant risk to the health or safety of themselves or others. Requirements are representative of the minimum level of knowledge, skills, and ability. Page 4 Created: January 2015 Page 37 of 479 Class Code: XXXXX Proposed Grade: 20 FLSA: E CITY OF BOYNTON BEACH, FLORIDA CLASSIFICATION SPECIFICATION CLASSIFICATION TITLE: EXECUTIVE ASSISTANT PURPOSE OF CLASSIFICATION The purpose of this classification is to perform professional and administrative work directly under the supervision of the City Manager and in support of the department office staff. Responsible for the supervision of the office clerical staff. Coordinates and performs various program and office administration duties relative to City operations. ESSENTIAL FUNCTIONS The following duties and functions, as outlined herein, are intended to be representative of the type of tasks performed within this classification. They are not listed in any order of importance. The omission of specific statements of the duties or functions does not exclude them from the classification if the work is similar, related, or a logical assignment for this classification. Other duties may be required and assigned. Supervises the department’s clerical staff; duties include developing work schedules, assigning, directing and supervising daily work; providing instruction and guidance; reviewing completed work to ensure compliance with policies, procedures, and guidelines; ensuring safety procedures are followed; and coordinating and providing training as needed. Approves personnel leave requests. Delegates authority and responsibility to subordinates with appropriate guidelines and follow up; seeks maximum productivity from work unit/department. Provides constructive criticism when coaching others; listens to views of others; and acknowledges accomplishments of others. Interprets and explains City and department policies and procedures to employees and the general public; assists the City Manager in implementing new programs and changes in department policies and procedures. Assists City Manager with certain assigned duties of the office and participates with departments in accomplishment of activities necessary for City operations; works under only general supervision using specialized or technical knowledge required. Plans, enacts, and monitors special programs, projects and activities as directed by the City Manager. Executes special assignments. Keeps supervisor informed of changes in the status of important projects; and makes timely adjustments to projections. Monitors, allocates and schedules resources to ensure accomplishment of program goals. Assures equal opportunity in the work place and works toward accomplishment of cultural and workforce diversity by implementing affirmative action goals. Conducts program and policy research; completes department surveys. Page 1 Created: March 2015 Page 38 of 479 City of Boynton Beach, Florida • Executive Assistant XXXXX Resolves unusual questions/problems; investigates complaints and requests for service; takes appropriate action to resolve issues consistent with policy; resolves conflicts and disagreements among others. Researches variables and alternatives before making decisions. Determines and communicates the priority of issues and devises time frames for specific tasks and recommendations. Maintains close contact with all municipal departments in order to assist departments in meeting operational objectives as appropriate. Performs secretarial duties for department; schedules and arranges meetings and appointments; drafts and types business correspondence; organizes department meetings; makes travel arrangements; takes dictation and transcribes letters, minutes, and statements; answers and screens telephone calls; assists staff, visitors and others. Reviews administrative documents and forms in absence of the City Manager. Establishes and maintains the department’s central records and computer files which may include employee files, personnel records, accounting records, budgets, purchasing and payroll forms, department projects, contracts, legal documents, ordinances and resolutions, meeting minutes, policies and procedures, work orders, and service requests. Composes and types various activity and statistical reports, correspondence and memos, department newsletter articles, and others. Attends department staff meetings and takes meeting minutes. Prepares and/or reviews department payroll; prepares purchase requisitions and orders; coordinates inventory systems; reviews and processes Employee Activity Reports (EARs). Prepares required paperwork, forms and/or worksheets according to policies/procedures. Updates logs as needed to indicate progress on various jobs. Supervises data-entry and maintenance of department accountingrecords, accounts and reports; reviews and approves additions, deletions, and changes to accounts; oversees customer billing activity; reviews related financial reports; prepares, reconciles and balances cash receipts reports and trial balances; maintains central files for accounting, purchasing, and budgeting. Assists in preparation of the Annual City Budget; analyzes budget requests; researches budget-related matters; tracks pertinent data to facilitate budget planning; monitors expenditures to remain within established budget; develops revenue projections for next fiscal year; recommends reductions and changes in department spending for budget compliance; reviews and prepares budget transfers/amendments for justification, fiscal impact and conformance with applicable policies/procedures; and maintains the department’s budget records Serves as staff liaison in coordinating the delivery of city programs and services with other departments and agencies; logs and processes related forms and records; coordinates changes to work schedules, project priorities, and management directives to staff; maintains department files and records. Coordinates the review and resolution of citizen complaints and problems. Follows the expectations regarding the ethical conduct of profession and position. Exercises discretion and independent judgment. Page 2 Created: March 2015 Page 39 of 479 City of Boynton Beach, Florida • Executive Assistant XXXXX Receives, prioritizes and distributes the department’s mail. Oversees the proper operation and maintenance of the department’s computer hardware, software and peripherals; coordinates repair and maintenance needs; coordinates system improvements and upgrades; performs computer back-ups; sets up user files and passwords. Participates in conducting event, program and class registrations; receives registration applications and payments; maintains registration cards and materials. Orders office supplies, materials, uniforms and sale merchandise; checks shipments for accuracy and approves invoices for payment; maintains inventory records and files. ADDITIONAL FUNCTIONS Reviews and revises procedures to implement changes and improvements; makes suggestions to improve operational procedures. Reviews and updates Administrative Policy Manual according to City policy, subject to review by department heads and City Manager approval. May advise the City Manager with administrative details relative to day-to-day functions of City government. May assist in the recruitment, interviewing and selection of assigned clerical staff. May prepare City Commission agenda items, and board meeting agendas and meeting minutes. Provides staff support to City advisory board and authority members. Researches programming offered by other entities/organizations to eliminate duplication of services. Develops methods/strategies to meet program objectives complete with timetable and work plan. Allocates resources for accomplishment of goals. Mutually sets objectives with subordinates; conducts time efficient meetings to achieve results. Operates a motor vehicle to conduct work activities. Provides assistance or coverage to other employees as needed. Performs other related duties as required. KNOWLEDGE, SKILLS, AND ABILITIES Demonstrates working knowledge of relevant legal issues, rules and regulations within the profession and the ability to effectively utilize legal resources when necessary leading to knowledgeable decisions. Skilled at understanding and carrying out complex oral and written instructions. Skilled at learning and adjusting well to new methods, conditions, and change. Skilled at projecting a positive, professional image when dealing with the general public. Demonstrated effective oral and written communication skills and ability to convey ideas and information in Page 3 Created: March 2015 Page 40 of 479 City of Boynton Beach, Florida • Executive Assistant XXXXX a clear and concise manner. Ability to establish and maintain effective working relationship with supervisors, subordinates, employees, Elected Officials, other departments/agencies. Ability to exercise sound judgment in analyzing facts and arriving at conclusions. Ability to identify irregularities and potential problems before they become critical. Ability to make appropriate decisions and react with good judgment in changing situations or under pressure. Ability to make unpopular or difficult decisions. Ability to organize work and use time effectively and efficiently. Ability to perform mathematical calculations. MINIMUM QUALIFICATIONS Associates degree in public administration, business administration, business management, or related field. Three (3) years progressively responsible experience and/or training that includes related office and administrative work, preferably in a local government organization. Must possess and maintain a valid Florida driver’s license. PREFERRED QUALIFICATIONS Bachelor’s degree in public administration, business administration, business management, or related field. PHYSICAL AND SENSORY REQUIREMENTS / ENVIRONMENTAL FACTORS Physical Ability : Tasks require the ability to exert light physical effort in sedentary to light work, but which may involve some lifting, carrying, pushing and/or pulling of objects and materials of light weight (10 pounds). Tasks may involve extended periods of time at a keyboard or work station. Sensory Requirements : Some tasks require the ability to perceive and discriminate sounds, and visual cues or signals. Some tasks require the ability to communicate orally. Environmental Factors : Essential functions are regularly performed without exposure to adverse environmental conditions. The City of Boynton Beach, Florida, is an Equal Opportunity Employer. In compliance with the Americans with Disabilities Act (42 U.S. C. 12101 et. seq.), the City of Boynton Beach will provide reasonable accommodations to qualified individuals with disabilities and encourages both prospective and current employees to discuss potential accommodations with the employer. The physical demands described are representative of those that must be met by an employee to successfully perform the essential functions of this job. A review of this position has excluded the marginal functions of the position that are incidental to the performance of fundamental job duties. All duties and responsibilities are essential job functions and requirements are subject to possible modifications to reasonably accommodate individuals with disabilities. To perform this job successfully, the incumbent(s) will possess the abilities and aptitudes to perform each Page 4 Created: March 2015 Page 41 of 479 City of Boynton Beach, Florida • Executive Assistant XXXXX duty proficiently. Some requirements may exclude individuals who pose a direct threat of significant risk to the health or safety of themselves or others. Requirements are representative of the minimum level of knowledge, skills, and ability. Page 5 Created: March 2015 Page 42 of 479 CITY OF BOYNTON BEACH BUDGET YEAR 2014-2015 PERSONNEL ALLOCATION DEPARTMENT:City ManageFUND: 001 r DIVISION:DEPT. NO.: 1210 PositionPay2012/132013/142014/15Mar-152014/15 Position TitleNumberGradeActualActualAdoptedRevisionRevised Full-Time Positions: City Manager01019981.01.01.00.01.0 Assistant City Manager 01029461.01.01.00.01.0 Assistant to the City Manager01099341.00.00.00.00.0 Communications Manager01079301.01.00.00.00.0 Grants Coordinator62079181.01.01.00.01.0 Administrative Associate00370101.01.01.0(1.0)0.0 Special Projects Coordinator#####170.00.00.01.01.0 Admin. Asst. to the City Manager00259201.01.01.0(1.0)0.0 Executive Assistant#####200.00.00.01.01.0 7.06.05.00.05.0 Total Personnel:7.06.05.00.05.0 Page 43 of 479 Page 44 of 479 Page 45 of 479 Page 46 of 479 Page 47 of 479 EXHIBIT A CITY OF BOYNTON BEACH, FLORIDA GENERAL FUND ANALYSIS STATEMENT OF REVENUES - COMPARATIVE BUDGET TO ACTUAL Fiscal Year Period Ended January 31, 2015 (33% of Fiscal Year) REVENUES FY 2014-15FY 2014-15 TO DATEFY 2013-14 TO DATE FY 2013-14 ACCOUNTS %%REVENUE REVENUE REALIZEDREALIZED APPROVEDREALIZEDAPPROVEDREALIZED AD VALOREM TAXES, net32,304,232$ 27,763,858$ 86%29,736,573$ 25,379,756 85% LESS TIF TAXES TO CRA(5,186,878) (5,186,878) 100%(4,428,166)(4,428,166) 100% NET TAXES TO THE CITY27,117,354 22,576,980 83%25,308,40720,951,590 83% LICENSES AND PERMITS FRANCHISE FEES4,420,000 1,672,356 38%4,434,575 1,580,576 36% BUSINESS TAXES1,390,000 1,356,333 98%1,390,000 1,295,387 93% BUILDING PERMITS2,115,000 588,704 28%1,662,600 668,449 40% OTHR LICENSES, FEES & PER170,000 138,321 81%171,300 125,321 73% INTERGOVERNMENTAL REVENUES OTHER FEDERAL REVENUE55,000 13,088 24%55,000 12,036 22% STATE SHARED REVENUES7,724,000 2,438,418 32%7,072,000 2,267,643 32% SHRD REV FROM OTHR LCL440,000 159,743 36%415,000 242,720 58% CHARGES FOR SERVICES PYMTS IN LIEU OF TAXES104,000 121,647 117%104,000 104,698 101% CHRGS-GENERAL GOVT616,798 204,747 33%614,600 195,882 32% PUBLIC SAFETY4,383,605 2,349,160 54%4,075,100 1,691,108 41% PHYSICAL ENVIRONMENT20,000 7,700 39%20,000 13,246 66% CULTURE/RECREATION353,000 152,412 43%331,000 135,075 41% INTEREST & MISC REVENUE VIOLATIONS LOCAL ORD.440,000 242,840 55%355,000 226,133 64% INTEREST EARNINGS50,000 (5,696) -11%240,000 1,017 0% RENTS AND ROYALTIES351,000 105,415 30%338,800 96,059 28% SPECIAL ASSESSMENTS5,542,000 4,725,516 85%4,977,000 3,105,282 62% SALE OF SURPLUS MATERIAL2,000 42 2%2,000 499 25% LIBRARY FINES30,000 6,858 23%30,000 5,998 20% OTHER MISC. REVENUE237,000 50,189 21%288,900 76,532 26% INTERNAL FUND TRANSFERS TRANSFERS16,518,000 5,506,000 33%16,711,115 5,422,667 32% FUND BALANCE APPROPRIATED951,781 317,260 33%2,820,106 940,035 33% Total Revenues 73,030,538$ 42,728,033$ 59%71,416,503$ 39,157,953 55% $80,000 Two Year Cumulative Revenue Comparison and CFY $72,540 Budget -($ in thousands) $72,223 $70,000 $69,000 $65,532 $60,000 $61,571 $57,360 $53,529 $50,000 $48,826 $42,728 $43,833 $40,000 $37,945 $39,025 $33,602 $30,000 $20,000 $14,394 $15,923 $10,000 $4,770 $4,389 $0 OctNovDecJanFebMarAprMayJunJulAugSep Cumulative201314ActualCumulative201415Actual201415Budget Page 48 of 479 S:\Finance\Financial Reports\Monthly Financial Reports\FY2014-2015\Budget Review - GF - thru Jan 15 Summarized001 Revenue Summary Revised2/20/2015 EXHIBIT B CITY OF BOYNTON BEACH, FLORIDA GENERAL FUND ANALYSIS STATEMENT OF EXPENDITURES - COMPARATIVE BUDGET TO ACTUAL Fiscal Year Period Ended January 31, 2015 (33% of Fiscal Year) EXPENDITURES FY 2014-15 FY 2013-14 FY 2013-14 TO DATE FY 2014-15 TO DATE ACCOUNTS BUDGET BUDGET %% EXPENDEDEXPENDED EXPENDEDEXPENDED APPROVEDAPPROVED GENERAL GOVERNMENT CITY COMMISSION252,374$ 89,537$ 35%270,049$ 101,497$ 38% CITY MANAGER617,775311,56750%777,917360,38846% CITY HALL/GEN. ADMIN.2,771,218592,94021%2,164,446579,75927% MARKETING /COMMUNICATIONS180,64632,19818%000% CITY CLERK555,142219,29240%571,810214,83838% CITY ATTORNEY596,893155,34426%735,597172,74323% FINANCIAL SERVICES1,163,228510,85244%1,105,077487,83744% ITS1,917,477813,02742%1,834,455819,67645% HUMAN RESOURCES735,597308,59142%785,682357,03945% PUBLIC SAFETY COMMUNICATIONS000%2,426,3811,074,97744% UNIFORM SERVICES12,932,5818,141,05663%25,011,29911,441,74146% ADMINISTRATIVE SERVICES6,736,6932,310,29534%000% SUPPORT SERVICES8,417,2602,807,88933%000% CODE COMPLIANCE000%957,574419,44044% FIRE21,117,1539,958,73947%20,147,2369,660,33248% EMERGENCY MANAGEMENT81,9143,1654%83,56410,34912% BUILDING & DEVELOPMENT DEVELOPMENT873,199367,09842%817,527371,56845% BUILDING1,049,796448,21943%1,248,679490,92739% ENGINEERING656,356297,69445%706,395323,30946% PLANNING & ZONING699,511322,43546%675,073323,51748% ECONOMIC DEVELOPMENT344,23985,34225%254,35179,32031% PUBLIC WORKS PUBLIC WORKS231,907104,99745%243,056107,67944% FACILITIES MANAGEMENT1,583,462593,45237%1,532,499585,45138% STREETS MAINTENANCE1,064,169412,56939%1,087,637347,95032% LEISURE SERVICES LIBRARY2,234,621932,52742%2,218,651943,52443% SCHOOLHOUSE MUSEUM SERV336,444152,58345%227,855 73,59832% RECREATION2,874,6301,231,93543%2,823,6141,158,01941% PARKS & GROUNDS3,006,253826,94428%2,710,079911,24034% CRA REIMBURSABLE & RESERVES- 16,6920%- 1,3140% Total Expenditures73,030,538$ 32,046,979$ 44%71,416,503$ 31,418,032$ 44% $80,000 Two Year Cumulative Expenditure Comparison and $73,031 CFY Budget -($ in thousands) $70,000 $69,347 $64,531 $60,000 $58,023 $53,514 $50,000 $48,961 $44,759 $40,000 $40,202 $35,750 $32,047 $30,000 $31,418 $26,017 $21,511 $25,510 $20,000 $17,074 $20,817 $16,320 $10,000 $6,086 $0 OctNovDecJanFebMarAprMayJunJulAugSep Cumulative201314ActualCumulative201415Actual201415Budget Page 49 of 479 S:\Finance\Financial Reports\Monthly Financial Reports\FY2014-2015\Budget Review - GF - thru Jan 15 Summarized001 Expenditure Summary Revised2/20/2015 EXHIBIT C CITY OF BOYNTON BEACH, FLORIDA UTILITY FUND ANALYSIS STATEMENT OF REVENUES - COMPARATIVE BUDGET TO ACTUAL Fiscal Year Period Ended January 31, 2015 (33% of Fiscal Year) REVENUES FY 2014-15 TO DATEFY 2013-14 TO DATE FY 2014-15 FY 2013-14 ACCOUNTSBUDGET BUDGET REVENUE %%REVENUE APPROVEDAPPROVED REALIZEDREALIZED REALIZEDREALIZED WATER SALES18,400,000$ 6,696,321$ 36%18,000,000$ 6,435,224$ 36% WATER CONNECTION FEE10,000 11,835 118%50,000 15,780 32% WATER SERVICE CHARGE 319,910500,000 64%900,000 389,114 43% WTR-BACKFLOW PREVNTR TEST5,000 - 0%50,000 - 0% RECLAIMED WATER SALES40,000 27,792 69%30,000 15,226 51% SEWER SERVICE17,254,000 5,932,364 34%16,800,000 5,761,617 34% STORMWATER UTILITY FEE3,610,000 1,249,962 35%3,670,000 1,205,360 33% TELEVISE SEWER LINES7,000 - 0%20,000 2,648 13% FEES10,000 - 0%15,000 4,171 28% INTEREST INCOME50,000 8,375 17%20,000 - 0% SALE OF SURPLUS EQUIP.- 1,144 0%4,000 - 0% OCEAN RGE UT TAX ADM CHG800 183 23%800 198 25% BAD DEBT RECOVERIES500 - 0%500 33 7% MISCELLANEOUS INCOME- 712 0%5,000 - 0% TRANSFER FROM SANITATION FUND 33,667101,000 33%101,000 33,667 33% FUND BALANCE DECREASE (INCREASE) 117,743353,230 33%(49,176) (16,392) 33% TOTAL REVENUES40,341,530$ 14,400,008$ 36%39,617,124$ 13,846,646$ 35% $50,000 Two Year Cumulative Revenues Comparison and CFY Budget -($ in thousands) $41,641 $40,342 $40,000 $38,268 $34,834 $31,391 $30,000 $27,885 $24,244 $20,000 $20,628 $17,341 $14,400 $13,847 $10,569 $10,000 $10,311 $7,014 $6,706 $3,425 $3,205 $0 OctNovDecJanFebMarAprMayJunJulAugSep Cumulative201314ActualCumulative201415Actual201415Budget Page 50 of 479 S:\Finance\Financial Reports\Monthly Financial Reports\FY2014-2015\Budget Review - UF - thru Jan 15 Summarized401 Rev Sum EXHIBIT D CITY OF BOYNTON BEACH, FLORIDA UTILITY FUND ANALYSIS STATEMENT OF EXPENDITURES - COMPARATIVE BUDGET TO ACTUAL Fiscal Year Period Ended January 31, 2015 (33% of Fiscal Year) EXPENDITURES FY 2013-14 TO DATE FY 2014-15 FY 2014-15 TO DATEFY 2013-14 ACCOUNTSBUDGET BUDGET %% EXPENDEDEXPENDED APPROVEDAPPROVED EXPENDEDEXPENDED WATER DISTRIBUTION1,503,426$ 559,454$ 37%1,517,181$ 589,920$ 39% PUBLIC WATER TREATMENT6,046,180 2,129,283 35%6,247,733 2,293,442 37% METER READING & SERVICES930,185 401,385 43%843,627 356,913 42% WASTEWATER COLLECTION1,594,212 593,966 37%1,596,979 640,296 40% WASTEWATER PUMPING STATNS2,455,872 919,190 37%2,546,226 952,031 37% SEWAGE TREATMENT3,723,000 1,202,107 32%3,987,000 1,084,955 27% WATER QUALITY671,548 287,770 43%725,412 328,759 45% UTILITY ADMINISTRATION13,500,014 4,111,061 30%12,399,551 4,075,893 33% UTILITES ENGINEERING1,320,956 551,509 42%1,331,802 566,904 43% STORMWATER MAINTENANCE956,034 330,208 35%869,024 253,645 29% CUSTOMER RELATIONS1,558,019 530,823 34%1,382,627 553,266 40% DEBT SERVICE6,082,084 2,058,615 34%6,169,962 2,052,938 33% Total Expenditures40,341,530$ 13,675,371$ 34%39,617,124$ 13,748,962$ 35% $50,000 Two Year Cumulative Expenditures Comparison and CFY Budget -($ in thousands) $40,342 $40,000 $38,062 $34,712 $31,516 $30,000 $28,468 $25,664 $22,781 $20,000 $19,713 $16,936 $13,675 $13,749 $10,504 $10,000 $10,476 $7,606 $7,581 $4,736 $4,565 $0 OctNovDecJanFebMarAprMayJunJulAugSep Cumulative201314ActualCumulative201415Actual201415Budget Page 51 of 479 S:\Finance\Financial Reports\Monthly Financial Reports\FY2014-2015\Budget Review - UF - thru Jan 15 Summarized401 Exp Sum Page 52 of 479 Page 53 of 479 Page 54 of 479 Page 55 of 479 Page 56 of 479 Page 57 of 479 Page 58 of 479 Page 59 of 479 Page 60 of 479 Page 61 of 479 Page 62 of 479 Page 63 of 479 Page 64 of 479 Page 65 of 479 Page 66 of 479 Page 67 of 479 Breakdown of Project Pricing by CIP Account - Overview BudgetBase GMPDifferential Phase 1 Contract Amount (Shown in individual elements below)$1,131,770 Phase 2 Design and Construction Costs (Amendment No. 1) CIP HTE AccountBudgetBase GMPDifferential Project # FundDept/ DivExp AcctObj CodeProject Name$30,859,205$30,803,124(56,081) East Plant Rehab - Replacement capacity, valves, controls, etc. (2.1A - 2.1F, 403501053365.02WTR 1122.1H - 2.1.J)$7,985,094$8,192,842207,748 403501053365.02WTR 112East Plant Rehab - Groundwater Rule Regulation Requirements (2.1G)$698,280 $599,890(98,390) East Plant Growth Changes - Storage Tank, High Service Pumps, etc. (2.2A - 404500053365.01WTR 1122.2D)1$4,260,000$4,996,545$736,545 404500053365.01WTR 136Ion Exchange System (2.3A - 2.3D)$16,397,998$15,285,560($1,112,438) Security Upgrades - Improved Employee Parking, Perimeter Protection, 403500053365.02WTR 127and Surveillance Entry (2.4A)$230,000$438,129$208,129 403500053365.02WTR 008Admin Building - A/C, Roofing, etc. (2.4B)$387,833$428,382$40,549 403500053631.91Alternative Energy Evaluation$100,000$89,800($10,200) 403501053365.02WTR 112East Plant Rehabilitation - Offices, etc. (2.4B)$300,000$369,844$69,844 403500053365.02WTR 115Water Treatment Plant Expansion & Rehabilitation$500,000$402,132($97,868) TOTAL$30,859,205$30,803,124($56,081) Page 68 of 479 Breakdown of Project Pricing by CIP Account - Detailed View BudgetBase GMPDifferential Phase 1 Contract Amount (Shown in individual elements below)$1,131,770 $- Phase 2 Design and Construction Costs (Amendment No. 1) CIP HTE AccountBudgetBase GMPDifferential Project # FundDept/ DivExp AcctObj CodeProject Name$30,859,205$30,803,124(56,081) East Plant Rehab - Replacement capacity, valves, controls, etc. (2.1A - 2.1F, 2.1H - 2.1.J) 403501053365.02WTR 112$7,985,094$8,192,842207,748 - Phase 1$224,233 - Civil Site Preparation; Site Layout, Stormwater Modifications$860,520 - Miscellaneous Yard Piping$393,098 - Miscellaneous Demolition and Repairs$251,587 - Existing Lime Softeners Rehabilitation$154,389 - Filter Modifications and Valve Replacement$2,468,302 - East WTP Operations Building Improvements$558,652 - Lime Silos (Demolition and Replacement In Kind)$897,523 - High Service Pump Station$770,635 - Electrical and Instrumentation Modifications$1,540,635 - Art in Public Places$73,268 403501053365.02WTR 112East Plant Rehab - Groundwater Rule Regulation Requirements (2.1G)$698,280 $599,890(98,390) - Phase 1 $16,392 - Free Chlorination control $578,142 - Art in Public Places$5,356 East Plant Growth Changes - Storage Tank, High Service Pumps, etc. (2.2A - 404500053365.01WTR 1122.2D)1 $4,260,000$4,996,545$736,545 - Phase 1 $136,784 - Site Preparation and Yard Piping$381,177 - Repump Station and Electrical Building$2,259,766 - 350 kW Generator$244,230 - 3MG Ground Storage Tank$1,929,895 - Art in Public Places$44,693 404500053365.01WTR 136Ion Exchange System (2.3A - 2.3D)$16,397,998$15,285,560($1,112,438) - Phase 1$418,307 - East Plant MIEX$12,246,855 - MIEX Resin$1,320,102 - West Plant Piping Reconfiguration Work$839,188 - Programming$324,426 - Art in Public Places$136,682 Security Upgrades - Improved Employee Parking, Perimeter Protection, and Surveillance Entry (2.4A) 403500053365.02WTR 127$230,000$438,129$208,129 403500053365.02WTR 008Admin Building - A/C, Roofing, etc. (2.4B)$387,833$428,382$40,549 - Site Improvements$239,574 - A/C, Roofing etc$188,808 403500053631.91Alternative Energy Evaluation$100,000$89,800($10,200) - Climate Action Plan$89,800 403501053365.02WTR 112East Plant Rehabilitation - Offices, etc. (2.4B)$300,000$369,844$69,844 403500053365.02WTR 115Water Treatment Plant Expansion & Rehabilitation$500,000$402,132($97,868) - Phase 1 - East Water Treatment Plant SCADA upgrading$336,054 - Asset Management System$66,078 TOTAL$30,859,205$30,803,124($56,081) Page 69 of 479 Ion Exchange Resin Plant and East Water Treatment Plant Improvements Project City Of Boynton Beach, Florida Price Proposal Scope Of Work February 11, 2015 PHASE I: QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments Progessive Design-Build 1Review of Alternative Design/Value Engineering and Design Definition Meeting 1LS$ 87,7680.3%Y 2Permitting Coordination and Field Work 1LS$ 72,8790.2%Y 3Design Development 1LS$ 204,900 0.7%Y 4GMP Pricing 1LS$ 102,400 0.3%Y 5Meetings and Project Management 1LS$ 60,0000.2%Y Phase I Engineering SUBTOTAL 1LS$ 527,9471.7% 6Early Construction Activities 1LS$ 603,823 1.9%/Pac Van, Merchant, ATW, DCR Engineering, Admiral Plumbing, Electron Phase I Early Construction SUBTOTAL$ 603,8231.9% PHASE I CONTRACT TOTAL 1LS$ 1,131,7703.6%Lump SumLump Sum per Attachment "G" Special Conditions 20. a) PHASE II: GMP QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments Engineering 1CDM Smith - Preliminary Evaluations and Support 1LS$ 85,000 0.3%Y 1.1 Preliminary Evaluation for Architectural Improvements, Chiller System, etc.No Fee 1LS$ 45,0000.1%YCDM Smith 1.2 Envision SupportNo Fee 1LS$ 40,0000.1%YCDM Smith 2CDM Smith - Survey and GeotechnicalFee 1LS$ 24,000 0.1%/ 2.1 CDM Field Survey and Locate Work (Field Work)Fee 1LS$ 4,0000.0%YCDM Smith 2.2 Topographic Field Survey and LocatesFee 1LS$ 10,0000.0%NEngenuity Group Inc.Local Business Used in Phase I 2.3 Geotechnical InvestigationsFee 1LS$ 10,0000.0%NTierra Of South Florida, Inc.Local Business Used in Phase I 3CDM Smith - Design and Engineering Services 1LS$ 974,2003.1%YCDM Smith 3.1 CDM Smith Off-Site DesignNo Fee 1LS$ 948,200 3.0%YCDM SmithPer Attachment "B" 4.4.3 3.2 CDM Smith On-Site DesignFee 15TP$ 20,0000.1%YCDM SmithPer Attachment "B" 4.4.1 3.3 CDM Smith On-Site Design (Travel Costs)Fee 1LS$ 6,0000.0%YCDM SmithPer Attachment "B" 4.4.5 4CDM Smith - Subcontracted Design ConsultantsFee 1LS$ 810,0002.6%N 4.1 Ion Exchange System - Design and EngineeringFee 1LS$ 650,000 2.1%NCarollo Design Build GroupMiex Specialty Consultant per Attachment "B" 4.4.6 4.1 Ion Exchange System - Engineer's Construction ServicesFee 1LS$ 150,000 0.5%NCarollo Design Build GroupMiex Specialty Consultant per Attachment "B" 4.4.6 4.3 Architectural Improvements - Design and Engineering ServicesFee 1LS$ 10,0000.0%NAW Architects, Inc.Local Business - Specialty Consultant per Attachment "B" 4.4.6 5CDM Smith - Construction Services 16MO$ 505,5001.6%Y 5.1 CDM Smith Off-Site Engineering Services during ConstructionNo Fee 16MO$ 453,500 1.5%YCDM SmithPer Attachment "B" 4.4.3 5.2 CDM Smith On-Site Engineering Services during ConstructionFee 30TP$ 40,0000.1%YCDM SmithPer Attachment "B" 4.4.1 5.3 CDM Smith On-Site Engineering Services during Construction (Travel Costs)Fee 12MO$ 12,0000.0%YCDM SmithPer Attachment "B" 4.4.5 Engineering SUBTOTAL 1 LS$ 2,398,7007.7%Lump Sum Engineering SUBTOTAL (Excluded from D/B Fee)$ 1,486,7004.8%Per Attachment "B" 4.4.3 Engineering SUBTOTAL (Included in D/B Fee)$ 912,0002.9%Per Attachment "B" 4.4.1 C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx1 of 9 Page 70 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments Bonds 5.1 BondsNo Fee 1EA$ 261,328 0.8%NZurichPer Attachment "B" 4.4.13 and Attachment "G" 20. b) 5.2 Bonds (CDBG)Fee 1EA$ 61,5590.2%NCDBG CarrierPer Attachment "B" 4.4.6 Bonds SUBTOTAL 1 LS$ 322,8871.0%Fixed Price Bonds SUBTOTAL (Excluded from D/B Fee)$ 261,3280.8%Per Attachment "B" 4.4.13 Bonds SUBTOTAL (Included in D/B Fee)$ 61,559 0.2%Per Attachment "B" 4.4.6 Insurnace 6.1 InsuranceNo Fee 1LS$ 159,048 0.5%NPer Attachment "B" 4.4.13 and Attachment "G" 20. b) 6.2 Insurance (CDBG)Fee 1LS$ 236,441 0.8%NCDBG Carrier Insurance SUBTOTAL 1 LS$ 395,489.00 1.3%Lump Sum Insurnace SUBTOTAL (Excluded from D/B Fee)$ 159,0480.5%Per Attachment "B" 4.4.13 Insurance SUBTOTAL (Included in D/B Fee)$ 236,4410.8%Per Attachment "B" 4.4.6 PHASE II COST SUMMARY ;KĨŽƐƚƐƚŽďĞǆĐůƵĚĞĚ&ƌŽŵͬ&ĞĞͿ Engineering SUBTOTAL$ 1,486,7004.8%Per Attachment "B" 4.4.3 Bonds SUBTOTAL$ 261,3280.8%Per Attachment "B" 4.4.13 Insurance SUBTOTAL$ 159,0480.5%Per Attachment "B" 4.4.13 Subtotal Cost (Of Costs to be Excluded From D/B Fee) 1LS$ 1,907,0766.1% C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx2 of 9 Page 71 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments PHASE II: GMP Costs To Be Included In D/B FeeAddsQtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments Construction 01General Conditions 1LSPer Attachment "G" Special Conditions 20 Project Management 16MO$ 733,126 2.4%YPer Attachment "B" 4.4., 4.4.1, and 4.4.4 Burdens Field Staff 16MO$ 1,173,6653.8%YPer Attachment "B" 4.4., 4.4.1, and 4.4.4 Burdens Project Estimating 16MO$ 220,293 0.7%Y Project Controls 16MO$ 46,7330.2%Y Clerical Staff 16MO$ 137,577 0.4%Y Travel & Subsistence 16MO$ 109,048 0.4%YPer Attachment "B" 4.4.5 Training & Orientation 1LS$ 6,6120.0%YPer Attachment "B" 4.4.4 Temp. Sanitary Service 16MO$ 7,8020.0%NAll StarPer Attachment "B" 4.4.11 Temporary Power 1LS$ 13,5450.0%NElectronLow Bidder from Phase I Temp. Telephone & Comm. 1LS$ 11,9540.0%NComcastVerizonLow Bidder from Phase I CDM Field Offices 4MO$ 3,3920.0%NPac VanLow Bidder from Phase I CDM Field Office Equip/Supply 1LS$ 31,0610.1%NPer Attachment "B" 4.4.11 Temp Const Facilities 1LS$ 50,7540.2%YPer Attachment "B" 4.4.11 Const Equip & Small Tools 16MO$ 37,3970.1%YPer Attachment "B" 4.4.12 Safety 1LS$ 8,6830.0%YPer Attachment "B" 4.4.20 Security /Traffic/Pollution Control 1LS$ 6,3920.0%YPer Attachment "B" 4.4.9 Subcontractor Management Software 1LS$ 9,8790.0%NTexturaPer Attachment "B" 4.4.9 General Conditions SUBTOTAL 1LS$ 2,607,9138.4%Lump Sum 01Permits Lead and Asbestos Survey (Survey and Testing Only)$ 1,218.00 1LS$ 1,2180.0%NIBC EngineeringCompleted on 10/23/2014 Gopher Tortoise Survey and Relocation$ 14,405 1LS$ 14,4050.0%NGopher Tortoise Services, Inc.Includes relocation for up to (5) Tortoises Dewatering Permit 1LS$ 500 0.0%YNPDES Demolition Permit (Health Department) 1LS$ 500 0.0%YHealth Department Construction Permit ALLOWANCE $ 50,000.00 1LS$ 50,0000.2%YCity Of Boynton Beach Building Department Permits SUBTOTAL$ 65,623 1LS$ 66,623 0.2%AllowancePer Attachment "B" 4.4.17 01Quality Assurance/Control Quality Assurance/Control ALLOWANCE $ 91,350.00 1LS$ 91,3500.3%NCooper ConsultingBoynton Beach Building Department Inspections Independent Testing Lab 1LS$ 22,5750.1%NTesting LabIncludes testing Carollo concrete Quality Assurance/Control SUBTOTAL$ 91,350 1LS$ 113,9250.4%AllowancePer Attachment "B" 4.4.8 and .17 01Envision Envision Program Registration Fee$ 27,950 1LS$ 27,9500.1%/EnvisionN/AN/A Envision SUBTOTAL$ 27,950 $ 27,950 0.1%Fixed PricePer Attachment "B" 4.4.17 and 21 01Public Relations Public Relations$ 44,340 1LS$ 44,3400.1%/Merchant Strategy Public Relations SUBTOTAL$ 44,340 $ 44,340 0.1%Fixed PricePer Attachment "B" 4.4.21 01Assett Management Asset Management Software$ 25,000 1LS$ 25,0000.1%/Mintek Asset Management Programming$ 25,000 1LS$ 25,0000.1%Y Assett Management SUBTOTAL$ 50,000 $ 50,000 0.2%Fixed PricePer Attachment "B" 4.4.21 C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx3 of 9 Page 72 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments 01Public Art Componet AllowanceBid Package:TBDTBDTBD Public Art Componet Allowance$ 260,000 1LS$ 260,000 0.8%N Artwork SUBTOTAL$ 260,000$ 260,0000.8%AllowancePer Attachment "B" 4.4.21 01Survey Initial Survey/Staking/Final Survey$ - 1LS$ 22,2600.1%/Engenuity Group Inc.Local Business Used in Phase I Survey SUBTOTAL$ -$ 22,260 0.1%Fixed Price Erosion Control Work PackageBid Package:ECMTBDTBD Erosion Control Subcontractor$ 22,290 1LS$ 22,2900.1%NSilt Fence, Inlet Protection Erosion Control SUBTOTAL$ 22,290 $ 22,290 0.1%Fixed Price 02Site Preparation Work PackageBid Package:Hard DrivesD.S. EkinsHiatt New South Entrance$ 58,870 1LS$ 58,8700.2%N Site Clearing 1LS$ 29,1380.1%N Site Grading 1AC$ 22,9610.1%N Site Preparation SUBTOTAL$ 58,870 $ 110,9690.4%Fixed Price 02Structural Demolition Work Package$ - Bid Package:PAW DemoGlassbrennerPenhallStandard Demolition Demo Vacuum Press Building (2nd Story Only) 1LS$ 81,1080.3%N Demo Sludge Thickener (Complete) 1LSincN Demo East Lime Contactor (Complete) 1LSincN Demo Lime Storage Silos 2EA$ 39,0780.1%NIn service, requires two moibilizations. Structural Demolition SUBTOTAL$ -$ 120,1860.4%Fixed Price 02Misc Demolition Work Package$ - Electrical Demolition of (2) Existing Generators 1LS$ 6,3750.0%Y Demo Existing TPS & HSPS Pumps and Patch Concrete Pads-Q$ 9,643.00 1LS$ 9,6430.0%Y Demo Existing Flouride System-Q$ 7,613.00 1LS$ 7,6130.0%Y Demo Existing Fence at New SW Plant Entrance$ 5,075.00 1LS$ 5,0750.0%Y Demo Allowance-Fill Gravity Thickener$ 7,105.00 12EA$ 7,1050.0%Y Demo Allowance-Temp Support 30" Pipe Softener to Filter$ 30,450.00 1LS$ 30,4500.1%Y Demo Allowance-Fill & Compact MIEX Foundation Area 8EA$ 20,3000.1%Y Demo Allowance-OSG Equipment-3 ea 7EA$ 30,4500.1%Y Demo for New Southwest Site Entrance Off Seacrest 1LS$ 8,7060.0%Y Curbs 500LF$ 5,2770.0%Y Misc Demolition SUBTOTAL$ 59,886 $ 130,9940.4%Allowance 02Earthwork Package 1LSHard DrivesD.S. EkinsHiatt Storm Pond Filling (for GST and PS)$ 239,653 1LS$ 239,653 0.8%NImport and compact under GST Stormwater Piping$ 43,818 578LF$ 43,8180.1%N Earthwork SUBTOTAL$ 283,471$ 283,4710.9%Allowance C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx4 of 9 Page 73 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments 02Underground Yard Piping Work PackageTBDTBDTBD 24" East Wellfield Raw Water Pipeline: 6.5 MGD 10" 2 MGD East Wellfield Bypass Direct to Filters 100LF$ 50,8050.2% 24" x 10" Tapping Saddle, Isolation Valve, 10" Pipe, Flowmeter, Mod Valve 12" 1.5 MGD Western Wellfield to Softeners 60LF$ 63,2800.2% 30" x 12" Reducer, 12" Pipe, (2) 12" 45s, Flowmeter, Mod Valve, Vault, 24" x 12" Tap 30" West Wellfield Pipeline: 17.5 MGD 16 MGD West Wellfield to Miexincluded (BY CDBG) 30" 16 MGD West Miex Effluent to Softeners w/ bypass to Filters 230LF$ 138,624 0.4% 12" Miex Contactor Tank Drain Line (to wash water drain pipe) 60LF$ 19,7420.1% 24" DIP Saddle, 12" Ductile Iron Pipe, Fittings New Re-Pump Station 20" Pump Station Suction 1LS$ 30,1900.1%Y 20" Pump Station Discharge 1LS$ 197,170 0.6%Y 16" ASR Well Flushing Line Extension (260 LF) and flume 260LF$ 47,2050.2%NNew ASR Well flushing line Modify Existing Tower Control Valve 1LS$ 6,0900.0%Internals Re-Pump Station Tank Isolation Valves 1LS$ 21,4030.1%N Dewatering 1LS$ 10,1500.0%N Underground Yard Piping SUBTOTAL$ -$ 584,6591.9%Fixed Price 02Site Fencing Work PackageSmithCenturyGood Neighbor Permanent Plant Security Fencing Subcontractor$ 182,749 3,250LF$ 182,749 0.6%NAluminum Pickett, Chain Link New Automatic Rolling Traffic Fence/Gates$ 76,125 3EA$ 76,1250.2%N Site Fencing SUBTOTAL$ 258,874$ 258,8740.8%Fixed Price 02Paving Work PackageTBDTBDTBD Asphalt Patching and Replacement, Parking Bumpers$ 184,357 4,954SY$ 184,357 0.6%NHard DrivesGeneral AsphaltCommunity Asphalt 1" Asphalt Overlay$ - - SY$ - 0.0%NOverlay Removed Paving SUBTOTAL$ 184,357$ 184,3570.6%Allowance 02Site Restoration Work PackageTBDTBDTBD Reclaimed Sprinkler System Relocations and Repairs$ 10,150 1LS$ 10,1500.0%N Site Sidewalk and Curbs 1$ 57,8550.2%N Lawns and Grasses 129,000SF$ 13,1790.0%NHydrograssTBDTBD Site Restoration SUBTOTAL$ 10,150 $ 81,184 0.3%Allowance C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx5 of 9 Page 74 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments 03Structural Work PackageTBDTBDTBD Lime Storage North Lime Silo Replace Dilution Box 1EA$ 10,1500.0%N South Lime Silo Replace Dilution Box 1EA$ 10,1500.0%N Lime Softeners North Lime Softener Contact Tank Structural Steel Repair 250LB$ 12,6880.0%N Grout Injection 100LF$ 7,1050.0%N South Lime Softener Contact Tank Structural Steel Repair 250LB$ 12,6880.0%N Grout Injection 100LF$ 7,1050.0%N Finished Water Gravity Filters Concrete Repair 1CY$ 508 0.0%N Grout Injection 150LF$ 15,2250.0%N Existing Clearwell Pump/Drain Clearwells 1LS$ 46,4080.1% Construct Concrete Weir Wall (4 Log Disinfection) 1LS$ 36,5070.1% Grout Injection 200LF$ 20,3000.1%N Ladder Replacement 4EA$ 8,1200.0% Existing High Service Pump Room Concrete Repair 2CY$ 1,0150.0%N Grout Injection 40LF$ 4,0600.0%N Structural Improvements (Table E.2) Polyurethane Grout Crack Repair 1LS$ 81,2000.3%N Spalled and Cracked Concrete Repair 1LS$ 86,2750.3%N Structural SUBTOTAL$ -$ 359,5041.2%Allowance 04Architectural Work Package East Filter Gallery Entrance Work$ 59,434 1LS$ 59,4340.2%NNo elevator. Clinic Plumbing/Laboratory Plumbing$ 127,500 1LS$ 127,500 0.4%N 2nd Floor East & West Office Space Build Out$ 71,880.00 1LS$ 71,8800.2%NNo asbestos removal included. 1st Floor West Side (Medical Clinic)$ 62,366 1,500SF$ 62,3660.2%N Architectural SUBTOTAL$ 321,180$ 321,1801.0%Allowance 07Roofing Work Package Roofing Subcontractor$ 285,736 13,980SF$ 285,736 0.9%N Roofing SUBTOTAL$ 285,736$ 285,7360.9%Fixed Price 09Painting and Coating Work PackageExceletechSouthlandAdvanced PaintingUniversal Painting Subcontractor 1LS$ 92,7900.3%N Painting and Coating SUBTOTAL$ -$ 92,790 0.3%Fixed Price C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx6 of 9 Page 75 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments 11Lime Storage Work Package Lime Storage Replace Lime Storage Silos ($599,293) 2EA$ 598,974 1.9%YDACOTBDTBD Replace Lime Slurry Pumps 2EA$ 20,7890.1%Y Lime Softeners Core Additional Outlets in Softener 1LS$ 10,1500.0%NTrue-LineCore drill subcontractor. Repair Sludge Blow-Down Lines 1LS$ 30,4500.1%N Lime Storage SUBTOTAL$ -$ 660,3632.1%Allowance 11Ion Exchange Work Package East Plant Miex General 1LS$ 700,000 2.3%YCDBGN/AN/A CDBG Fee at 5.95% 1LS$ 555,000 1.8%YCDBGN/AN/A Division 2 Sitework 1LS$ 499,884 1.6%YCDBGN/AN/A Division 3 Concrete 1LS$ 965,360 3.1%YCDBGN/AN/A Division 5 Metals 1LS$ 321,038 1.0%YCDBGN/AN/A Division 7 1LS$ 6,3400.0%YCDBGN/AN/A Division 9 Coatings 1LS$ 220,274 0.7%NCDBGN/AN/ATo be bid. Division 11 Process Equipment 1LS$ 4,480,13314.4%YCDBG/OricaN/AN/ASole Source to Orica per Owner Contract. Division 13 Special Construction 1LS$ 184,535 0.6%NCDBGN/AN/ATo be bid. Division 15 Mechanical 1LS$ 659,436 2.1%YCDBGN/AN/A Division 16 Electrical 1LS$ 575,000 1.8%NCDBGN/AN/ATo be bid. Division 17 Instrumentation 1LS$ 100,000 0.3%NCDBGN/AN/A Miex Resin 1LS$ 998,900 3.2%NOricaN/AN/AOwner Direct Purchase Ion Exchange SUBTOTAL$ -$ 10,265,900 33.0%Fixed Price 11West Plant West Plant Piping Reconfiguration Work Division 2 Sitework 1LS$ 134,292 0.4%YCDBGN/AN/A Division 11 Process Equipment 1LS$ 66,6950.2%YCDBGN/AN/A Division 15 Mechanical 1LS$ 379,013 1.2%YCDBGN/AN/A Division 16 Electrical 1LS$ 55,0000.2%NCDBGN/AN/ATo be bid. West Plant SUBTOTAL$ -$ 635,0002.0%Fixed Price 13Ground Storage Tank Work Package Foundation & Load Bearing Elements 1LS$ 226,872 0.7%NHayward BakerEarth-TecTBD 3 MG Ground Storage Tank 3MG$ 1,202,9993.9%NCromPreconN/A Tank Exterior Architectural Treatments$ 30,450.00 1LS$ 30,4500.1%NCromPreconN/AArches Ground Storage Tank SUBTOTAL$ 30,450 $ 1,460,3214.7%Fixed Price 15Mechanical Work Package Mechanical Site MOPO Allowance 1LS$ - 0.0%YNone required. Work to be completed during Plant Shutdown Misc Piping Allowance 1LS$ 50,0000.2%YALLOWANCEUnidentified/Small diamter pipe repairs and relocates. Raw Water North Lime Softener Tank Clean and Seal Existing Pipes 4EA$ 4,1580.0%N Epoxy Pipe Liner 70LF$ 14,2100.0%N South Lime Softener Tank Clean and Seal Existing Pipes 4EA$ 4,0600.0%N C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx7 of 9 Page 76 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments Epoxy Pipe Liner 70LF$ 14,2100.0%N Chemical Systems Ammonia Storage Tank 1LS$ 10,3960.0%YTannerCould be leased by Owner. Ammoniator 1LS$ 20,7900.1%YW&T Finished Water Existing Gravity Filters Raise Overflow Pipe 1LS$ 10,3950.0%Y Replace Slide Gates in Correct Location 1LS$ 25,9870.1%Y Increase Backwash Pipe Size 150LF$ 101,499 0.3%Y Replace All Idendified Above Grade Valves and Actuators 92EA$ 1,698,2515.5%YIncludes Profibus actuators and conduit Existing Clearwell Sluice Gate Replacement 2EA$ 20,7890.1%Y Replace Clearwell Slide Gates and Valves 2LS$ 67,5650.2%Y Clearwell Additional Venting 2LS$ 10,3950.0%Y Relocate Chlorine and Ammonia Injections 5LS$ 12,9930.0%Y Existing High Service Pump Room Clean and Seal Existing Pipes 7EA$ 7,2760.0%N Existing High Service Pump Station Pump Replacement 7EA$ 583,127 1.9%YBased upon existing Peerless footprint. Re-Pump Station New Re Pump Station 1LS$ 393,807 1.3%/3 Pumps, 100 HP No canopy, no bridge crane. New Re Pump Station Electrical Building (20' x 10') 200SF$ 96,4370.3%NBuilding Subcontractor Solids Handling Backwash Water Recycle Replace/Add Pump VFD's (20HP) 2EA$ 663 0.0%NElectrical subcontractor installation. Mechancial SUBTOTAL$ -$ 3,147,00810.1%Fixed Price 15HVAC Subcontractor Work PackageTBDTBDTBD Conventional AC for Disturbed Area-Option 1$ 152,250 1LS$ 152,250 0.5%N HVAC Subcontractor SUBTOTAL$ 152,250$ 152,2500.5%Allowance 16Electrical Materials Package Electrical Gear Purchase 1LS$ 565,273 1.8%YSiemensSquare DCuttler Hammer 350 kw Electrical Generator Purchase (Tier 2) 1LS$ 184,805 0.6%YCumminsRing/Cat - No QuoteFuel by Owner. Tier 2 included. Electrical Materials SUBTOTAL$ -$ 750,0782.4%Fixed Price 16Electrical Subcontractor Work PackageCNFEdwardsGilmoreLoveland Electrical Subcontractor Work Package 1LS$ 1,298,2794.2%N Security Card System for Control Building$ 55,350 1LS$ 55,3500.2%NAccess control at Filter Building New Site Lighting$ 51,683 31EA$ 51,6830.2%NNo mods to existing lighting Electrical Subcontractor SUBTOTAL$ 107,033$ 1,405,3124.5%Fixed Price% of Phase II Construction Cost 17Instrumentation Subcontractor Work PackageDCR Eng.RevereTrihedral Fiber Optic Relocation (under Miex Regeneration Slab)$ 25,000.00 1LS$ 25,0000.1%NALLOWANCE Instrumentation Subcontractor Allowance 1LS$ 736,465 2.4%NALLOWANCE Instrumentation Subcontractor SUBTOTAL$ 25,000 $ 761,4652.4%Allowance% of Phase II Construction Cost Phase II Construction SUBTOTAL$ 2,338,810 $ 22,658,989 72.9%% of Phase II Total Cost C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx8 of 9 Page 77 of 479 QtyUnitEstimate%Vendor 1Vendor 2Vendor 3Comments PHASE II COST SUMMARY ;KĨŽƐƚƐƚŽďĞǆĐůƵĚĞĚ&ƌŽŵͬ&ĞĞͿ Engineering SUBTOTAL$ 1,486,7004.8% Bonds SUBTOTAL$ 261,3280.8% Insurance SUBTOTAL$ 159,0480.5% Subtotal Cost (Of Costs to be Excluded From D/B Fee)$ 1,907,0766.1% PHASE II COST SUMMARY ;KĨŽƐƚƐƚŽďĞ/ŶĐůƵĚĞĚ/Ŷͬ&ĞĞͿ Engineering SUBTOTAL (Included in D/B Fee)$ 912,0002.9%Per Attachment "B" 4.4.6 Bonds SUBTOTAL (Included in D/B Fee)$ 61,559 0.2%Per Attachment "B" 4.4.6 Insurance SUBTOTAL (Included in D/B Fee)$ 236,4410.8%Per Attachment "B" 4.4.6 Phase II General Conditions SUBTOTAL$ 2,607,9138.4% Phase II Construction SUBTOTAL$ 2,338,810 $ 22,658,989 72.9% Phase II Construction Contingency 1 1LS$ -0.0%ContingencyPer Attachment "G" 20. b) Subtotal Cost (Of Costs to be Included In D/B Fee)$ 26,476,902 85.2% D/B Fee @ 5.95%$ 139,159$ 1,575,3765.07%Per Design-Build Contract Total Cost (Of Costs to be Included In D/B Fee) and Fee$ 28,052,278 90.2% PHASE II COST SUMMARY Total Cost (Of Costs to be Excluded From D/B Fee)$ 1,907,0766.1% Total Cost (Of Costs to be Included In D/B Fee) and Fee$ 28,052,278 90.2% PHASE II TOTAL (All Engineering, Bonds, Insurance, Construction, and Fee)$ 29,959,354 96.4% PROJECT COST SUMMARY Phase I TOTAL$ 1,131,7703.6% Phase II TOTAL$ 29,959,354 96.4% 2 PROJECT GRAND TOTAL (NO CONTINGENCY) GMP$ 31,091,124100% Notes 1 Owner Direct Purchases: Our proposal for the Contract Price is provided on the basis of a Guaranteed Maximum Price for the Phase 2 Services. Our proposal includes our estimated cost of Orica Miex Equipment (1)$ (3,000,000) the work and our Fee. No Contingency Allowances are included in our Proposal for Orica Resin$ (800,000) items outside of the Contract Documents or our Design-Build Proposal Documents Lime Silos (2)$ (300,000) listed below. High Service Pumps (7)$ (270,000) Re-Pumps (3)$ (90,000) 2 Electrical Gear$ (220,000) Contract Documents Progressive Design Build Agreement dated July 2, 2014 Emergency Generator (1)$ (120,000) Ageement Amendment No. 1 Total Owner Direct Purchases$ 4,800,0006%$ 288,000Sales Tax Balance Of Contract$ 26,291,124 2 $ 31,091,124 $ 31,091,124CDM Smith Final Contract Amount (before Tax Savings) Design-Build Proposal Documents GMP Proposal Letter dated February 11, 2015 Less Owner Tax Savings$ 288,000 $ 288,000Contract Less Sales Tax Savings Price Proposal Scope Of Work dated February 11, 2015$ 30,803,124 Contract After Tax Savings$ 30,803,124 Price Proposal Clarifications Assumptions, and Exceptions dated February 11, 2015$ 4,800,000Contract Less Owner Direct Purchases Price Proposal Drawing Package dated February 11, 2015 $ 26,003,124CDM Smith Final Contract Amount Preliminary Design Report (PDR) submitted to the Palm Beach County Health Department dated February 5, 2015$ 4,800,000Plus Owner Direct Purchases $ 30,803,124Boynton Beach Total Project Cost C:\Users\walkerjl\Documents\CDM Smith\104887 Boynton Beach Ion Exchange\Boynton Beach\02112014 Boynton Price Proposal Scope Of Work.xlsx9 of 9 Page 78 of 479 N Figure 2-1 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EXISTING SITE PLAN Page 79 of 479 N Figure 2-2 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements PROPOSED SITE HORIZONTAL CONTROL PLAN Page 80 of 479 Figure 4-1 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EAST WTP EXISTING PROCESS BLOCK FLOW DIAGRAM Page 81 of 479 Figure 4-2 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EAST WTP PROPOSED PROCESS BLOCK FLOW DIAGRAM Page 82 of 479 N 30" RW 24" D.I. 24" RW MIEX CONTRACT BASIN (PROPOSED) NORTH SOFTENER PLAN Figure 4-3 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements PROPOSED RAW PIPING MODIFICATIONS - EAST Page 83 of 479 Page 84 of 479 New 36-inch Water Line 1 with 24-inch Isolation, Pressure Sustaining and Flow Control Valves 2 3 Proposed Unloading Station 2 Area Existing CIP Waste Solution 3 Pumps 1 Figure 4-5 City of Boynton Beach, Florida Anionic Exchange Resin Facility and West Water Treatment Plant Improvements KEWdh>^/dW>EDK/&/d/KE^ʹt^dtdW JAN 2015 Page 85 of 479 WELL 13W TO 36-INCH WELL 12W 1 TRANSMISSION LINE EXISTING CARTRIDGE EXISTING FIRST FILTERS STAGE FEED PUMPS EXISTING WELLFIELD New 36-inch Water Line with 24-inch 1 Isolation, Pressure Sustaining, and Flow Control Valves Figure 4-6 City of Boynton Beach, Florida Anionic Exchange Resin Facility and West Water Treatment Plant Improvements WZKWK^ZttdZ^hWW>zDK/&/d/KE^^,Dd/ʹt^dtdW JAN 2015 Page 86 of 479 FROM FROM DUAL CLEANING ZONE TANK MONITORING WELL BRINE WASTE TO DEEP INJECTION WELL (EXISTING TO REMAIN) (EXISTING TO REMAIN) (EXISTING TO REMAIN) PROPOSED UNLOADING STATION WITH QUICK CONNECT Figure 4-7 City of Boynton Beach, Florida BRINE WASTE TRANSFER Anionic Exchange Resin Facility and West Water Treatment Plant Improvements TRUCK FROM EAST WTP WZKWK^/Wt^d^K>hd/KE^z^dDDK/&/d/KE^&>Kt^,Dd/ʹt^dtdW JAN 2015 Page 87 of 479 Figure 4-8 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements MIEX^z^dDWZK^^^,Dd/ʹ^dtdW JAN 2015 Page 88 of 479 Figure 4-9 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements MIEX® CONTACTOR SECTION I JAN 2015 Page 89 of 479 Figure 4-10 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements MIEX® CONTACTOR SECTION II JAN 2015 Page 90 of 479 P-CW-0101 Figure 4-11 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EAST WTP CLEARWELL P&ID Page 91 of 479 N PLAN Figure 4-12 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements CLEARWELL MODIFICATIONS PLAN Page 92 of 479 RVSS-EW-0707RVSS-EW-0808VFD-EW-0101VFD-EW-0202VFD-EW-0303RVSS-EW-0505RVSS-EW-0606 P-EW-0707 P-EW-0808 P-EW-0101 P-EW-0202 P-EW-0303 P-EW-0505 P-EW-0606 Figure 4-13 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EAST WTP HIGH SERVICE PUMP STATION P&ID Page 93 of 479 N PLAN Figure 4-14 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EAST WTP REPUMP STATION AND GST - PROPOSED YARD PIPING PLAN Page 94 of 479 RVSS-EH-0101RVSS-EH-0202RVSS-EH-0303 P-EH-0101 P-EH-0202 P-EH-0303 T-EH-0404T-EH-0606 Figure 4-15 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements EAST WTP PLANT FINISHED WATER STORAGE AND REPUMP STATION P&ID Page 95 of 479 NN PLANPLAN Figure 4-16 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements CONTROL BUILDING FIRST FLOOR CONSTRUCTION PLAN Page 96 of 479 N PLAN Figure 4-17 City Of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements CONTROL BUILDING SECOND FLOOR CONSTRUCTION PLAN Page 97 of 479 SWITCHBOARD-1 EMERGENCY LOAD SCHEDULE (LEFT SIDE) SWITCHBOARD-1 NORMAL LOAD SCHEDULE SINGLE LINE POWER DIAGRAM Figure 4-18 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements SWITCHBOARD-1 SINGLE LINE POWER DIAGRAM Page 98 of 479 PLAN Figure 4-19 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements CONTROL BUILDING - ELECTRICAL PLAN Page 99 of 479 PLAN Figure 4-20 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements REPUMP STATION ELECTRICAL BUILDING PLAN Page 100 of 479 MCC-5 LOAD SCHEDULE SINGLE LINE POWER DIAGRAM Figure 4-21 City of Boynton Beach, Florida Anionic Exchange Resin Facility and East Water Treatment Plant Improvements REPUMP STATION AND MCC-5 SINGLE LINE POWER DIAGRAM Page 101 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT EXISTING SITE PLAN BOYNTON BEACH C-2 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 102 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT EXISTING SITE PLAN BOYNTON BEACH C-3 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 103 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT DEMOLITION PLAN BOYNTON BEACH C-4 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 104 of 479 SEE SHEET C-6 FOR YARD PIPIPING PLAN - NORTHEAST SEE SHEET C-10 FOR PAVING, GRADING AND DRAINAGE PLAN - NORTHEAST SEE SHEET C-8 FOR YARD PIPIPING PLAN - SOUTHEAST N SEE SHEET C-12 FOR PAVING, GRADING AND DRAINAGE PLAN - SOUTHEAST SEE SHEET C-7 FOR YARD PIPIPING PLAN - NORTHWEST SEE SHEET C-11 FOR PAVING, GRADING AND DRAINAGE PLAN - NORTHWEST SEE SHEET C-9 FOR YARD PIPIPING PLAN -SOUTHEAST SEE SHEET C-13 FOR PAVING, GRADING AND DRAINAGE PLAN - SOUTHEAST CITY OF BOYNTON BEACH UTILITIES DEPARTMENT PROPOSED SITE HORIZONTAL CONTROL PLAN BOYNTON BEACH C-5 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 105 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT YARD PIPING PLAN - NORTHEAST BOYNTON BEACH C-6 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 106 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT YARD PIPING PLAN - NORTHWEST BOYNTON BEACH C-7 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 107 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT YARD PIPING PLAN - NORTHWEST BOYNTON BEACH C-8 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 108 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT YARD PIPING PLAN - SOUTHWEST BOYNTON BEACH C-9 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 109 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT PAVING, GRADING AND BOYNTON BEACH DRAINAGE PLAN - NORTHEAST C-10 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 110 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT PAVING, GRADING AND BOYNTON BEACH DRAINAGE PLAN - NORTHWEST C-11 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 111 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT PAVING, GRADING AND BOYNTON BEACH DRAINAGE PLAN - NORTHEAST C-12 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 112 of 479 N CITY OF BOYNTON BEACH UTILITIES DEPARTMENT PAVING, GRADING AND BOYNTON BEACH DRAINAGE PLAN - SOUTHWEST C-13 1601 Belvedere Road, Suite 400 East EAST WATER TREATMENT PLANT West Palm Beach, FL 33406 Tel: (561) 689-3336 FL COA No. EB-0000020 SITE PLAN REVIEW Page 113 of 479 Page 114 of 479 Page 115 of 479 Page 116 of 479 Page 117 of 479 Page 118 of 479 Page 119 of 479 Page 120 of 479 Page 121 of 479 Page 122 of 479 Page 123 of 479 Page 124 of 479 Page 125 of 479 Page 126 of 479 Page 127 of 479 Page 128 of 479 Page 129 of 479 Page 130 of 479 Page 131 of 479 Page 132 of 479 Page 133 of 479 Page 134 of 479 Page 135 of 479 Page 136 of 479 Page 137 of 479 Page 138 of 479 Page 139 of 479 Page 140 of 479 Page 141 of 479 Page 142 of 479 Page 143 of 479 Page 144 of 479 Page 145 of 479 Page 146 of 479 Page 147 of 479 Page 148 of 479 Page 149 of 479 PUNTA GORDA, CITY OF FLORIDA PHONE: (941) 575-3351 PROCUREMENT DIVISION FAX: (941) 575-3340 326 West Marion Avenue Punta Gorda, Florida, 33950 February6,2015 CityofBoyntonBeach Attn:JulianneAlibrandi,SeniorBuyer 100EastBoyntonBeachBoulevard BoyntonBeach,FL33435 RE:AUTHORIZATIONTOPIGGYBACK FORMALBID#R2010107/CHEMSULFCONT/1011 DearMs.Alibrandi, PleaseacceptthisletterasauthorizationfortheCityofBoyntonBeachtopiggybacktheŝƚǇ͛Ɛcurrent contractforSulfideOdorControlawardedtoEvoquaWaterTechnoligies,LLC(fkaSiemensWater Technologies,LLC)ofSarasota,Florida. BoyntonBeachshallestablishitsowncontract,placeitsownorderstopurchasethematerialsand/or servicesspecifiedinthecontractattheestablishedrates,beinvoicedbyandmakepaymenttothe awardedvendor. TheinitialcontractperiodisAugust22,2011throughAugust21,2016.Thevendorstatedamaximum of6%increaseperyearforthesecond,third,fourthandfifthyearsoftheinitialcontractperiod,which thevendormustrequestandjustifyinwriting.Therehasbeennoincreaseforthiscontracttodate. Ifyourequireadditionalinformation,pleasedonothesitatetocontactmeattheabovetelephone number. Sincerely, CITYOFPUNTAGORDA //s// DeborahJAdams,CPPB SeniorPurchasingAgent&ContractAdministrator Page 150 of 479 Page 151 of 479 Page 152 of 479 Page 153 of 479 Page 154 of 479 Page 155 of 479 Page 156 of 479 Page 157 of 479 Page 158 of 479 Page 159 of 479 Page 160 of 479 Page 161 of 479 Page 162 of 479 Page 163 of 479 Page 164 of 479 Page 165 of 479 Page 166 of 479 Page 167 of 479 Page 168 of 479 Page 169 of 479 Page 170 of 479 Page 171 of 479 Page 172 of 479 Page 173 of 479 Page 174 of 479 Page 175 of 479 Page 176 of 479 Page 177 of 479 Page 178 of 479 Page 179 of 479 Page 180 of 479 Page 181 of 479 Page 182 of 479 Exhibit ‘A’ Location Map: Portion of Lake Drive Page 183 of 479 Page 184 of 479 Page 185 of 479 Page 186 of 479 Page 187 of 479 Page 188 of 479 Page 189 of 479 Page 190 of 479 Page 191 of 479 Page 192 of 479 Page 193 of 479 Page 194 of 479 Page 195 of 479 Page 196 of 479 Page 197 of 479 Page 198 of 479 Page 199 of 479 Page 200 of 479 Page 201 of 479 Page 202 of 479 Page 203 of 479 Page 204 of 479 Page 205 of 479 Page 206 of 479 Page 207 of 479 Page 208 of 479 Page 209 of 479 Page 210 of 479 Page 211 of 479 Page 212 of 479 EXHIBIT "A" CASA DEL MAR SITE LOCATION MAP PROJECT SITE ¯ 140700140 Feet Page 213 of 479 Page 214 of 479 %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ -2()<83(6%;-2+7 %6',-8)'896%0 /,SZRERMER'SQTERMIW00' 8'3:)64%+) ;IWX*VSRX7XVIIX 6IH&ERO2. %'31192-8=7-8)40%2 XIP %3:)6%00+6392(*033640%2 %3:)6%007)'32(*033640%2 %3:)6%008,-6(*033640%2 %92-8%*033640%27 %)2(92-8%*033640%27 HEXI ETTVSZIH %92-8%*033640%27 NSFRS %*6328%2(6)%6)0):%8-327&9-0(-2+ 8=4-'%0 VIZMWMSRW %*6328%2(6)%6)0):%8-327&9-0(-2+3 )2,%2')( %0)*8%2(6-+,87-())0):%8-327 %()8%-07 %633*40%2 7-8) 6)79&1-8%0 7)%0 WLIIXRS SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 215 of 479 7-8)&9-0(-2+'%0'7 ,+8 '3()-2*361%8-32 &9-0(-2+,)-+,8-71)%796)(*631*-2-7, &%7)(32*036-(%&9-0(-2+'3() *0336831)%2,)-+,83*633* '327869'8-328=4) 7836=&9-0(-2+7 8=4):&746-2/0)( &)(&%8,7;348&%8,7 97)%2(3''94%2'='0%77-*-'%8-32 &9-0(-2+ 92-877* %% &9-0(-2+ 92-877* 66)7-()28-%03''94%2'-)7 )%',92-883&)730(%7*))7-140) 7398,(-<-),-+,;%=79-8) &9-0(-2+ 92-877* ,)-+,8%2(%6)% 8%&0) ;)784%01&)%',*0 &9-0(-2+ 92-877* 8)0*%< 1%<7->)&9-0(-2+8,6))7836=*))8920-1-8)(7**06*36 &9-0(-2+ 92-877* ;)&7-8)[[[]VEHIWMKRGSQ 8=4):&'327869'8-32 &9-0(-2+ 92-877* )1%-0]VE$]VEMRGGSQ 7)'8-32746-2/0)67=78)1-2'6)%7)7836= &9-0(-2+ 92-877* ,)-+,81%<-191&9-0(-2+,)-+,87836-)7*))8920-1-8)( %6)% &9-0(-2+ 92-877* 3''94%2'=8)2%287)4%6%8-32 &9-0(-2+ 92-877* 7)'8-3283;2,397)*-6)7)4%6%8-32 &9-0(-2+ 92-877* *-6)86)%8)(;33(*362380)778,%2)%',7-() &9-0(-2+ 92-877* 0)778,%28,6))7836-)77-2+0);%001%=&)97)( &9-0(-2+ 92-877* ,396*-6)6%8)( '328-29397*631*392(%8-32837,)%8,-2+ &9-0(-2+ 92-877* 92-877869'896%00=-2()4)2()28 *-6)4638)'8-327=78)17 7836=&9-0(-2+7 %7TVMROPIV7]WXIQ 6IUYMVIH4VSZMHIH &)(&%8,7;3488,&(61&%8, &7XERHTMTI7]WXIQ 6IUYMVIH4VSZMHIH &9-0(-2+ 92-877* '*MVI 6IUYMVIH4VSZMHIH (*MVI%PEVQ 6IUYMVIH4VSZMHIH 7836=&9-0(-2+ /,SZRERMER'SQTERMIW00' )4SVXEFPI*MVI)\XMRKYMWLIV 6IUYMVIH4VSZMHIH &)(&%8,7;3488,&(61&%8, ;IWX*VSRX7XVIIX *-2-7,'0%77-*-'%8-32 6IH&ERO2. &9-0(-2+ 92-877* XIP 1-2-28)6-36*-2-7,'0%77& +)2)6%0238) HEXI %0040%2779&1-88)(*364)61-88-2+7,%001))88,)'-8=7'3()7%2(8,)ETTVSZIH %440-'%&0)&9-0(-2+'3()7-2)**)'8%88,)8-1)3*4)61-879&1-88%0 NSFRS VIZMWMSRW 8LI4IRMRWYPE-49( '%&%2% 7,%()( &%8, %00:9% 7*&&5 836)')-:) **) 7836=7836=7* ()'36%8-:) 7836= 896*4%:)6 **)!2%:(**)!2%:( 4%:)1)1)28 **)!2%:( *40&90/86%7, 86%278=44-'/94 4330 %6)% 7836= 7836= **)!2%:( **)!2%:( %091 46-:%8) 4-'/)8 &3%870-47 +%8)()<-8 *3'%043-28%68 7* *)2') *,8=4 )0):%8)( '32' 34436892-8=8=449&0-' +6392( ;%0/8=4 ;33()2 '%00&3< 0):)04%8-3 70-47 7836= &3%6(;%0/7836= *3'%043-28%68 **)!2%:(32)%', 8=4**)!2%:( 34436892-8=8=4 92-88=4 '%234= +%8)()286= +%0 6)'='0) 1%-0&3< '328%-2)67 7-8) 03'%8-32 7836= 7836=7836= **)!2%:( **)!2%:(**)!2%:( '%234= 6)79&1-8%0 78%683* =(:)68-'%0'314%'836 ;34%59)%091-291 *03%8-2+(3'/7 7'6))2 )28-6))%784634)68= 0-2)%(.%')2883 %'92-88=4 -';;7,%006)')-:)% 7836= 7836= 7836= 7836= 2);7)%;%00 **)!2%:( **)!2%:( **)!2%:( **)!2%:( 2368,92-87 )<-78-2+1%2+63:) 7)%0 7836= 327398,,%0*3* 7398,92-8 )%78&392(%6=83&) 7836= **)!2%:( %08)6)(32')4)61-87 *631*()4%2(%'3) %6)3&8%-2)( (MQMGO6H +%8)(4)()786-%2 6; '322)'8-328=4 %0914-'/)8 49&0-' *)2')328343*;%00 %'')77 )<7*6)7-()2') )%7)1)28 )<,-+, '32';%00 )<7* )<7* )<7*6)7-()2') )<7*6)7 )1)6+)2'=)+6)77 6)7 78%&-0->)(896* 6)7 +%8)( WLIIXRS 7-8)40%2 2368, 7'%0)!! SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 216 of 479 0)+)2( &9-0(-2+%6)%'%0'90%8-327&9-0(-2+%6)%'%0'90%8-327&9-0(-2+%6)%'%0'90%8-327 1%7326='327869'8-32 &%88-2790%8-32 92-877836=&9-0(-2+92-877836=&9-0(-2+92-877836=&9-0(-2+ 7))*033640%2 <92-8%)2(<92-8%<92-8% <92-8%)2(<92-8%<92-8% <92-8%)2(<92-8%<92-8% 7392(&%887 7))*033640%2 '037)(')00*3%1-2790%8-32 7))*033640%2 838%09%3*92-87%%2(%838%09%3*92-87%%2(%838%09%3*92-87%%2(% 232&)%6-2+*6%1)( 7*<7*7*<7*7*<7* '327869'8-32 %% 232&)%6-2+*6%1)( 7398,(-<-),-+,;%=79-8) '327869'8-32;%00%&3:)838%09%3*92-8%)2(838%09%3*92-8%)2(838%09%3*92-8%)2( 36,-(()2 ;)784%01&)%',*0 7*7*7* 7*<7*<7*< 8)0*%< &)%6-2+*6%1)'327869'8-32 ;)&7-8)[[[]VEHIWMKRGSQ 838%09%3*&9-0(-2+7*838%09%3*&9-0(-2+7*838%09%3*&9-0(-2+7* )1%-0]VE$]VEMRGGSQ 73**-8%7238)(3240%2 838%0+%6%+)7 7*< 7*838%0+%6%+)7 7*< 7*838%0+%6%+)7 7*< 7* 838%0%6)%3*&9-0(-2+7*838%0%6)%3*&9-0(-2+7*838%0%6)%3*&9-0(-2+7* '3:)6)()286-)77*'3:)6)()286-)77*'3:)6)()286-)77* '3:)6)(4%8-3778*067*'3:)6)(4%8-3778*067*'3:)6)(4%8-3778*067* '3:)6)(&%0'32-)72(*067*'3:)6)(&%0'32-)72(*067*'3:)6)(&%0'32-)72(*067* 7*7*7* '3:)6)(&%0'32-)76(*06'3:)6)(&%0'32-)76(*06'3:)6)(&%0'32-)76(*06 838%0'3:)6)(%6)%7*838%0'3:)6)(%6)%7*838%0'3:)6)(%6)%7* *6328&%0'32-)77**6328&%0'32-)77**6328&%0'32-)77* 838%0%6)%3*&9-0(-2+7*838%0%6)%3*&9-0(-2+7*838%0%6)%3*&9-0(-2+7* /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP ,3%238) 8,))78%&0-7,)(,31)3;2)67%773'-%8-32;-00238 %003;-2(-:-(9%04330736%((-8-327%2(;-00238%003; 4%8-37436',)736&%0'32-)783&)13(-*-)( -) -2'6)%7)(-27->))2'037)(367'6))2)( HEXI ETTVSZIH NSFRS VIZMWMSRW 'SZIVIH4EXMS'SZIVIH4EXMS'SZIVIH4EXMS'SZIVIH4EXMS'SZIVIH4EXMS'SZIVIH4EXMS 3TX3TX 3TX3TX3TX3TX 4[HV4[HV 4[HV4[HV4[HV4[HV &SRYW&SRYW &SRYW&SRYW&SRYW&SRYW *EQMP]6Q*EQMP]6Q *EQMP]6Q*EQMP]6Q*EQMP]6Q*EQMP]6Q 7XSV7XSV7XSV7XSV 1IGL1IGL 1IGL1IGL1IGL1IGL 949494 949494 7-8) 6)79&1-8%0 7)%0 949494 949494 *S]IV*S]IV*S]IV*S]IV*S]IV*S]IV 'EV+EVEKI'EV+EVEKI'EV+EVEKI'EV+EVEKI'EV+EVEKI'EV+EVEKI 92-8%)2(92-8%92-8%92-8%92-8%92-8%)2( WLIIXRS SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 217 of 479 8=4-'%078%-6238)78=4-'%06%-0-2+238)70)+)2( +9%6(6%-07 ,%2(6%-07 1%7326='327869'8-32 6-7)6,)-+,87,%00238)<'))(4)6*&' 03%(-2+3*(-786-&98)(0-:)03%(7%7*3003;7 436',)7&%0'32-)7366%-7)(*0336796*%')7 %006)59-6)(,%2(6%-077,%00&)32)3*8,)& 8=4)--,%2(6%-07;-8,%4)6-1)8)6+6)%8)68,%27,%00 6&%88-2790%8-32 03'%8)(136)8,%2%&3:)8,)*033636+6%() *3003;-2+8=4)736463:-())59-:%0)28463:-()%+6%74%&0)*-2+)66)')77%6)%32&38,7-()73* +9%6(6%-07 0&7 7))*033640%2 7,%00,%:)+9%6(72380)778,%2-2,)-+,8 +6%74%&-0-8=8,)463*-0)8,)*-2+)66)')777,%00&)+-2;-8,-2%(-78%2')+9%6(6%-07-2*-00'31432)2870&7 0%2(-2+7%878%-6;%=77,%00'32*36183*&' 34)27-()73*78%-67;-8,%838%06-7)3*136)8,%2 7392(&%887 7))*033640%2 6:)68-'%06-7)7,%00238)<'))(*))8&)8;))23*1)%796)(:)68-'%00=*6318,)8%00)784368-323*8,) % 8=4)-,%2(6%-07;-8,%'-6'90%6'63777)'8-32 %&3:)8,)*033636+6%()&)03;7,%00,%:) *03360):)07360%2(-2+7 463*-0)%2(%',-):)%()48,3*%80)%78;-8,-2&)03;8,) 7,%00,%:)%23987-()(-%1)8)63*%80)%78%2(%7-2+0)'32')286%8)(03%(%440-)(-2%2=(-6)'8-32%8 '037)(')00*3%1-2790%8-32 +9%6(72380)778,%2-2,)-+,81)%796)( 7))*033640%2 ;-()784368-323*8,)463*-0)8,-76)59-6)(()48,7,%00 238+6)%8)68,%2-*8,),%2(6%-0-7238'-6'90%6%2=43-28%032+8,)834 :)68-'%00=*6318,)237-2+3*8,)86)%(7436',)7 86)%(()48,7,%00&)%80)%784)6*&' -87,%00,%:)%4)6-1)8)6(-1)27-323*%80)%78%2('328-29)*36%80)%7883%0):)08,%8-72380)778,%2 232&)%6-2+*6%1)( 6%2(()'/7;,-',%6))2'037)(;-8,-27)'8 +9%6(-2*-00'31432)287 %008,37))<')488,),%2(6%-0 '327869'8-32 &)03;8,)8%00)784368-323*8,)463*-0)8,)1-2-191;-(8, 7'6))2-2+7,%00&)463:-()(;-8,+9%6(7;,)6)8,)238+6)%8)68,%2;-8,%1%<-191'63777)'8-32 &%0978)67%2(4%2)0*-00)677,%00&)()7-+2)(83;-8,78%2( %% 232&)%6-2+*6%1)( 3*8,),%2(6%-0%&3:)8,)6)')777,%00&)83%1%<-191 ;%0/-2+796*%')-7136)8,%2%&3:)8,)*0336 (-1)27-323*%,36->328%00=%440-)(2361%003%(3*4392(732%2 '327869'8-32;%00%&3:)7398,(-<-),-+,;%=79-8) 36+6%()&)03;7,34(6%;-2+77,%00&)79&1-88)(%6)%)59%083759%6)*3388,-703%(2))(238&) 3*)(+)77,%00,%:)%1-2-1916%(-973*36,-(()2 ;)784%01&)%',*0 &=8,)&9-0()6%76)59)78)(&=8,)&9-0(-2+%7791)(83%'8'32'966)280=;-8,%2=38,)60-:)03%( ()4%681)286)59-6)1)288)0*%< &)%6-2+*6%1)'327869'8-32 ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ 73**-8%7238)(3240%2 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP HEXI ETTVSZIH NSFRS VIZMWMSRW 'SZIVIH(IGO'SZIVIH(IGO'SZIVIH(IGO'SZIVIH(IGO'SZIVIH(IGO'SZIVIH(IGO +VIEX6SSQ+VIEX6SSQ+VIEX6SSQ+VIEX6SSQ+VIEX6SSQ+VIEX6SSQ (MRMRK(MRMRK(MRMRK(MRMRK /MXGLIR/MXGLIR 949494949494 (2(2(2(2(2(2 /MXGLIR/MXGLIR/MXGLIR/MXGLIR 7-8) (MRMRK(MRMRK 6)79&1-8%0 4[H4[H4[H4[H4[H4[H 7)%0 92-8%)2(92-8%92-8%92-8%92-8%92-8%)2( WLIIXRS SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 218 of 479 0)+)2( 1%7326='327869'8-32 &%88-2790%8-32 7))*033640%2 7392(&%887 7))*033640%2 '037)(')00*3%1-2790%8-32 7))*033640%2 232&)%6-2+*6%1)( '327869'8-32 %% 232&)%6-2+*6%1)( '327869'8-32;%00%&3:)7398,(-<-),-+,;%=79-8) 36,-(()2 ;)784%01&)%',*0 8)0*%< &)%6-2+*6%1)'327869'8-32 ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ 73**-8%7238)(3240%2 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP HEXI ETTVSZIH NSFRS 'SZIVIH'SZIVIH'SZIVIH'SZIVIH'SZIVIH'SZIVIH VIZMWMSRW 4EXMS4EXMS4EXMS4EXMS4EXMS4EXMS 1EWXIV1EWXIV1EWXIV 7YMXI7YMXI7YMXI7YMXI &EXL&EXL&EXL&EXL&EXL&EXL 1EWXIV 1EWXIV 7YMXI7YMXI ;-';-';-';-';-';-' (2 (2(2(2(2(2 ,EPP&EXL,EPP&EXL,EPP&EXL,EPP&EXL,EPP&EXL,EPP&EXL 'P'P'P 0HV]0HV]0HV]0HV]0HV]0HV] 'P'P'P 7-8) &IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ&IHVSSQ 6)79&1-8%0 7)%0 92-8%)2(92-8%92-8%92-8%92-8%92-8%)2( WLIIXRS SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 219 of 479 0)+)2( 92-8%%6)%'%0'7 1%7326='327869'8-32 &%88-2790%8-32 7836= 7))*033640%2 4)692-8 7392(&%887 7))*033640%2 +6392(*069%7* '037)(')00*3%1-2790%8-32 7))*033640%2 7)'32(*069%7* 232&)%6-2+*6%1)( '327869'8-32 8,-6(*069%7* %% 232&)%6-2+*6%1)( '327869'8-32;%00%&3:)7398,(-<-),-+,;%=79-8) 36,-(()2 838%09%7* ;)784%01&)%',*0 '%6+%6%+)7* 8)0*%< &)%6-2+*6%1)'327869'8-32 ;)&7-8)[[[]VEHIWMKRGSQ 838%0%6)%4)692-87* )1%-0]VE$]VEMRGGSQ 73**-8%7238)(3240%2 348-32%0 7* '3:)6)()286= (91& ;%-8)6 '3:)6)(4%8-378*067* '3:)6)(&%0'32=2(*067* '3:)6)(&%0'32=6(*067* 838%0'3:)6)(%6)%7* 7,3;)6 *6328&%0'32-)77* 838%0%6)%3*92-87* 7XSV &EXL *0%8'0+ /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. 0%:0%: XIP 348-32%0 (91& ;' ;%-8)6 HEXI ETTVSZIH NSFRS VIZMWMSRW 1806%-0-2+ ()7-+28&( 7))8=4-'%06%-0-2+238)732 1806%-0-2+;,-+,%091-291*)2'),-+,%091-291*)2') 7,))8% :)68-'%0&%009786%()7 ()7-+28&( 7)) 8=4-'%06%-0-2+238)7 327,))8% 0-2)3*&%0'32=%&3:) 'SZIVIH 4EXMS 'SZIVIH4EXMS 'SZIVIH(IGO 1EWXIV 7YMXI 3TX *0%8'0+ **0 4[HV **0 *0%8'0+ &EXL ;' *0%8'0+ +VIEX &SRYW 6SSQ *EQMP]6Q 7XSV 0%: 0%: *0%8'0+ 6)*70%& *0%8'0+ 348-32%0 7))'-:-0(;+7 '%&-2)87 %,9 ;' %'',%7) 6%-0-2+ 1IGL <%88-' %'')77 :03. 94 94 ;-' 7-8) 66 );, *0%8'0+ (MRMRK 6SSQ 7XSV 6)79&1-8%0 )0)'4%2)0 :03. (2(2 *0%8'0+ 6 6 0%: ;' +%0)0)' ;%8)6,)%8)6 ,EPP&EXL *0%8'0+*36348-32%0 'P *36348-32%0;33( 348-32%0 (91&;%-8)6 (91&;%-8)67)):)2))6*%') *%1-0= 0HV] 7))40%2%&3:) 40%2%&3:) ')28)6 03;;%00 7)%0 $%** (; (&07-2/ '3928)6 ;(-74 '0 834$%** 0-2)3*3:)6,)%((336 0-2)3* 94 '%&7 6 %&3:) *S]IV &IHVSSQ&IHVSSQ /MXGLIR 0%:'EV+EVEKI *0%8'0+ *0%8'0+ *0%8'0+ *0%8'0+ '3928)6 834$ %** ;' 0-2)3*&9-0(-2+%&3:) WLIIXRS 1806%-0-2+; :)68-'%0 &%009786%()7 &EPGSR] ()7-+28&( 7)) 4[HV 8=4-'%06%-0-2+238)7 327,))8% 6Q 1806%-0-2+ ()7-+28&( 7))8=4-'%06%-0-2+238)732 7,))8% SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 220 of 479 0)+)2( 92-8%)2(%6)%'%0'7 1%7326='327869'8-32 &%88-2790%8-32 7836= 7))*033640%2 4)692-8 7392(&%887 7))*033640%2 +6392(*069%7* '037)(')00*3%1-2790%8-32 7))*033640%2 7)'32(*069%7* 232&)%6-2+*6%1)( '327869'8-32 8,-6(*069%7* %% 232&)%6-2+*6%1)( '327869'8-32;%00%&3:)7398,(-<-),-+,;%=79-8) 36,-(()2 838%09%7* ;)784%01&)%',*0 '%6+%6%+)7* 8)0*%< &)%6-2+*6%1)'327869'8-32 ;)&7-8)[[[]VEHIWMKRGSQ 838%0%6)%4)692-87* )1%-0]VE$]VEMRGGSQ 73**-8%7238)(3240%2 348-32%0 7* '3:)6)()286= (91& ;%-8)6 '3:)6)(4%8-378*067* '3:)6)(&%0'32=2(*067* '3:)6)(&%0'32=6(*067* 7,3;)6 838%0'3:)6)(%6)%7* *6328&%0'32-)77* 838%0%6)%3*92-87* &EXL *0%8'0+ /,SZRERMER'SQTERMIW00' 0%:0%: ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 348-32%0 ;' (91& ;%-8)6 HEXI ETTVSZIH 1806%-0-2+ ()7-+28&( 7))8=4-'%0 NSFRS 6%-0-2+238)7327,))8% VIZMWMSRW ,-+,%091-291*)2'),-+,%091-291*)2') 0-2)3*&%0'32=%&3:) 'SZIVIH <180 'SZIVIH(IGO '194-)6 ()7-+28&( 4EXMS 'SZIVIH4EXMS 3TX 7,3;)6 3[RIVW **0 &%8,89& 4[HV 7YMXI *0%8'0+ *0%8'0+ &EXL ;' **0 *0%8'0+ &SRYW +VIEX *EQMP]6Q 6SSQ 7XSV 0%:0%: 6)*70%& *0%8'0+ *0%8'0+ 7))'-:-0(;+7 %,9 ;' %'',%7) 6%-0-2+ 1IGL <%88-' %'')77 :03. 9494 ;-' 6 6 );, 6%-0-2+ 7-8) (MRMRK 6SSQ 6 7XSV (2(2 )0)'4%2)0 :03. *0%8'0+6 6)79&1-8%0 0%: ;' +%0)0)' ;%8)6,)%8)6 348-32%0 ,EPP&EXL*%1-0= ')28)6 (6= *0%8'0+ ;33( *36348-32%0 *36348-32%0 :)2))6*%') (91&;%-8)6 0HV](91&;%-8)6 'P 7))40%2%&3:) 7))40%2%&3:) ; 03;;%00 $%** 7)%0 (; (&07-2/'3928)6 ;(-74 834$%** 0-2)3*3:)6,)%((336 'P 0-2)3* 94 '%&-2)87 %&3:) 6 *S]IV &IHVSSQ&IHVSSQ /MXGLIR 'EV+EVEKI 0%: *0%8'0+*0%8'0+ *0%8'0+ '3928)6 4[HV*0%8'0+ 834$ %** ;' 0-2)3*&9-0(-2+%&3:) WLIIXRS &EPGSR] 1806%-0-2+ ()7-+28&( 7))8=4-'%06%-0-2+238)732 7,))8% 1806%-0-2+;:)68-'%0 &%009786%()7 ()7-+28&( 7)) 8=4-'%06%-0-2+238)7327,))8% SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 221 of 479 0)+)2( 92-8%%6)%'%0'7 1%7326='327869'8-32 &%88-2790%8-32 7836= 7))*033640%2 4)692-8 7392(&%887 7))*033640%2 +6392(*069%7* '037)(')00*3%1-2790%8-32 7))*033640%2 7)'32(*069%7* 232&)%6-2+*6%1)( '327869'8-32 8,-6(*069%7* %% 232&)%6-2+*6%1)( '327869'8-32;%00%&3:)7398,(-<-),-+,;%=79-8) 36,-(()2 838%09%7* ;)784%01&)%',*0 '%6+%6%+)7* 8)0*%< &)%6-2+*6%1)'327869'8-32 ;)&7-8)[[[]VEHIWMKRGSQ 838%0%6)%4)692-87* )1%-0]VE$]VEMRGGSQ 73**-8%7238)(3240%2 7* '3:)6)()286= '3:)6)(4%8-378*067* 348-32%0 '3:)6)(&%0'32=2(*067* (91& ;%-8)6 '3:)6)(&%0'32=6(*067* 838%0'3:)6)(%6)%7* *6328&%0'32-)77* 7,3;)6 838%0%6)%3*92-87* &EXL /,SZRERMER'SQTERMIW00' *0%8'0+ ;IWX*VSRX7XVIIX 6IH&ERO2. XIP 0%:0%: 348-32%0 ;'(91&;%-8)6 HEXI ETTVSZIH NSFRS VIZMWMSRW 1806%-0-2+;:)68-'%0&%009786%()7 ()7-+2 8&( 7))8=4-'%06%-0-2+238)7327,))8% 1806%-0-2+;,-+,%091-291*)2'),-+,%091-291*)2') :)68-'%0&%009786%()7 ()7-+28&( 7)) 8=4-'%06%-0-2+238)732 7,))8% 0-2)3*&%0'32=%&3:) 4EXMS 'SZIVIH(IGO 'SZIVIH4EXMS 1EWXIV 7YMXI 7,3;)6 3TX *0%8'0+ +VIEX &%8,89& 4[HV **0 6)*70%& **0 6SSQ *0%8'0+ 7))'-:-0(;+7 *0%8'0+ &EXL ;' *0%8'0+ &SRYW 348-32%0 *EQMP]6Q 7XSV '%&-2)87 0%: 0%: *0%8'0+ %'',%7) %,9 ;' /MXGLIR 6%-0-2+ 1IGL *0%8'0+ <%88-' %'')77 :03. 7-8) 94 ;-'94 -70%2( 6 );,6 *0%8'0+ 6%-0-2+ 6)79&1-8%0 (; 0-2)3*7XSV (2'%&-2)87(2 )0)'4%2)0 :03. %&3:) 6 6 0%: +%0)0)' ;' ;%8)6,)%8)6 *36348-32%0 (91&;%-8)6 ,EPP&EXL 7))40%2%&3:) ;%7, *0%8'0+ 03;;%00 *36348-32%0 $%** ;-' (91&;%-8)67)) 7)%0 40%27%&3:) (6= '3928)6 1; 834$ 348-32%0 %** *%1-0= ')28)6 ;33( '3928)6 :)2))6 834$%** *%') 0-2)3*3:)6,)%((336 '0 94 6 (MRMRK *S]IV &IHVSSQ&IHVSSQ 6SSQ 0%:'EV+EVEKI *0%8'0+*0%8'0+ *0%8'0+ *0%8'0+ ;' *900,)-+,8 '%&-2)8 WLIIXRS 4[HV 0-2)3*&9-0(-2+%&3:) 6Q 1806%-0-2+; :)68-'%0&%009786%()7 ()7-+28&( SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 222 of 479 8=4 8=4 1)%2,)-+,83*633* %% 7398,(-<-),-+,;%=79-8) 8=4 8=4 ;)784%01&)%',*0 8)0*%< 83&83& ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ 83&83& 6(*060:06(*060:0 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP RH*060:0RH*060:0 HEXI ETTVSZIH NSFRS VIZMWMSRW 8370%&8370%& 238) /)=)()0):%8-32238)7 &%'/*03;46):)28)677,%00&)4%-28)(831%8', ()'36%8-:)7,988)67 3;)27'362-2+7832)'90896)(7832) ()'36%8-:);33( ')1)284%:)67 86)1632,)6-8%+)'3036,)66-2+&32)4%88)62 8,)46-2'-4%07869'896)%2(7'6))2)(*631:-);'%787832)7-004-)6 7))% 3986-++)6 7))% 4%-28)(7,)6;-2;-00-%17&0%'/1%+-''3036 '36%07832)78=0) *377-06))*'3036 &6%'/)8 7))% )59-41)2840%')(32;%0073*&9-0-2+77,%00&) '%787832)'30912()'36%8-:);33(&6%'/)8 ()'36%8-:);33( 789''3*-2-7, 30(;360(/23'/(3;2 4%-28)(831%8',8,)&9-0(-2+'3036 *%9<;33(,)%()6 *0%8789''34%-28)(7,)6;-2;-00-%17430-7,)(1%,3+%2='3036)%+0)633*-2+633*8-0) 432()637%78=0)%2(7-)66%1%(6)'3036 324-)6 7))% 7))% &6%'/)8 7))% 4%-28)(7,)6;-2;-00-%171328)6)=;,-8) ()'36%8-:);33(&6%'/)8 ()'36%8-:);33( '%787832) 6%-0-2+7 8&( 4%-28)(7,)6;-2;-00-%17&0%'/1%+-''30364-)6 7))% ;-2(3;7%2(70-(-2++0%77(3367 &632>)*6%1) '034%=)<8)6-36(3367%2(+%6%+)(3367;;%0298*-2-7,'3036 7))% &6%'/)8 7))% '%787832)4-0%78)67 8=48=4 1)%2,)-+,83*633* 8=4 8=4 7-8) 83&83& 83&83& 6)79&1-8%0 6(*060:06(*060:0 7)%0 RH*060:0RH*060:0 WLIIXRS 8370%&8370%& SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 223 of 479 8=4 8=4 1)%2,)-+,83*633* %% 7398,(-<-),-+,;%=79-8) 8=4 8=4 ;)784%01&)%',*0 8)0*%< 83&83& ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ 83&83& 6(*060:06(*060:0 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP RH*060:0RH*060:0 HEXI ETTVSZIH NSFRS VIZMWMSRW 8370%&8370%& 238) /)=)()0):%8-32238)7 &%'/*03;46):)28)677,%00&)4%-28)(831%8', ()'36%8-:)7,988)67 3;)27'362-2+7832)'90896)(7832) ()'36%8-:);33( ')1)284%:)67 86)1632,)6-8%+)'3036,)66-2+&32)4%88)62 8,)46-2'-4%07869'896)%2(7'6))2)(*631:-);'%787832)7-004-)6 7))% 3986-++)6 7))% 4%-28)(7,)6;-2;-00-%17&0%'/1%+-''3036 '36%07832)78=0) *377-06))*'3036 &6%'/)8 7))% )59-41)2840%')(32;%0073*&9-0-2+77,%00&) '%787832)'30912()'36%8-:);33(&6%'/)8 ()'36%8-:);33( 789''3*-2-7, 30(;360(/23'/(3;2 4%-28)(831%8',8,)&9-0(-2+'3036 *%9<;33(,)%()6 *0%8789''34%-28)(7,)6;-2;-00-%17430-7,)(1%,3+%2='3036)%+0)633*-2+633*8-0) 432()637%78=0)%2(7-)66%1%(6)'3036 324-)6 7))% 7))% &6%'/)8 7))% 4%-28)(7,)6;-2;-00-%171328)6)=;,-8) ()'36%8-:);33(&6%'/)8 ()'36%8-:);33( '%787832) 6%-0-2+7 8&( 4%-28)(7,)6;-2;-00-%17&0%'/1%+-''30364-)6 7))% ;-2(3;7%2(70-(-2++0%77(3367 &632>)*6%1) '034%=)<8)6-36(3367%2(+%6%+)(3367;;%0298*-2-7,'3036 7))% &6%'/)8 7))% '%787832)4-0%78)67 8=48=4 1)%2,)-+,83*633* 8=4 8=4 83&83& 83&83& 6(*060:06(*060:0 7)%0 RH*060:0RH*060:0 WLIIXRS 8370%&8370%& SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 224 of 479 8=48=4 1)%2,)-+,83*633* %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8)0*%< 8=4 ;)&7-8)[[[]VEHIWMKRGSQ 8=4 )1%-0]VE$]VEMRGGSQ 83& 83& 83& 83& 6(*060:0 6(*060:0 /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP RH*060:0 RH*060:0 HEXI ETTVSZIH NSFRS VIZMWMSRW )0)'1)8)6 :03. %'%'%' '314'314'314 :03. :03. :03. 8370%&8370%& 8=48=4 1)%2,)-+,83*633* 8=4 8=4 83& 83& 7-8) 83& 83& 6)79&1-8%0 ')1)284%:)67 86)1632,)6-8%+)'3036,)66-2+&32)4%88)62 789''3*-2-7, 30(;360(/23'/(3;2 ;-8,7,)6;-2;-00-%171328)6)=;,-8) 6(*060:0 6(*060:0 '034%=)<8)6-36(3367%2(+%6%+)(3367;;%0298*-2-7,'3036 ()'36%8-:)7,988)67 %;2-2+74%-28)(7,)6;-2;-00-%17&0%'/1%+-''3036 7)%0 *0%8789''34%-28)(7,)6;-2;-00-%17430-7,)(1%,3+%2='3036 6%-0-2+74%-28)(7,)6;-2;-00-%17&0%'/1%+-''3036 3;)27'362-2+7832)'90896)(7832) '36%07832)78=0)%2(*377-06))*'3036 )%+0)633*-2+633*8-0) 432()637%78=0)%2(7-)66%1%(6)'3036 ;-2(3;7%2(70-(-2++0%77(3367 &632>)*6%1) RH*060:0 RH*060:0 '%787832)7-00 *%9<;33(,)%()6 '%787832) ()'36%8-:);33(&6%'/)8 7))% )0)'1)8)6 ()'36%8-:);33(&6%'/)8 7))% :03. :03. :03. :03. 4-)6 7))% '314'314'314 %'%'%' WLIIXRS 8370%&8370%& 4-)6 7))% '%787832)'30912324-)6 7))% ()'36%8-:);33(&6%'/)8 7))% 3986-++)6 7))% ()'36%8-:);33(&6%'/)8 7))% ()'36%8-:);33(&6%'/)8 7))% SJWLXW '%787832)4-0%78)67 'ST]VMKLX=6%(IWMKR-RG Page 225 of 479 %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ !! /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. XIP HEXI ETTVSZIH NSFRS VIZMWMSRW ! ! ! 7-8) 6)79&1-8%0 7)%0 WLIIXRS !!!! SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 226 of 479 %% 7398,(-<-),-+,;%=79-8) ;)784%01&)%',*0 8343*'32'6)8)&)%1 8)0*%< ;)&7-8)[[[]VEHIWMKRGSQ )1%-0]VE$]VEMRGGSQ &)%6-2+0)+)2( )0):7=1&30 6%/)( /,SZRERMER'SQTERMIW00' ;IWX*VSRX7XVIIX 6IH&ERO2. *-6)6%8)(73**-8 XIP HEXI ETTVSZIH NSFRS VIZMWMSRW % % 6-(+)6-(+) 7-8) 6)79&1-8%0 7)) % 8=4-'%0*-6) %6)%6)7)6:)(*36*-6) 6%8)(73**-8()8%-0 6)8%6(%2886)%8)(;33( 238)23633*4)2)86%8-32783&) 7,)%8,-2+&9-0(-2+'3() ;-8,-23*8)2%287)4%6%8-327)%0 7)'8-32 WLIIXRS SJWLXW 'ST]VMKLX=6%(IWMKR-RG Page 227 of 479 Page 228 of 479 Page 229 of 479 H.O.A. NOTE BUILDING 5 AREA CALCULATIONSBUILDING 6 AREA CALCULATIONS Y RA THE ESTABLISHED HOMEOWNERS ASSOCIATION WILL NOT D ESIGN ALLOW INDIVIDUAL POOLS OR ADDITIONS, AND WILL NOT ALLOW 5 UNITS, 4 STORY BUILDING5 UNITS, 4/3 STORY BUILDING (1 X 4 STORY UNIT A1END, PATIOS, PORCHES, OR BALCONIES TO BE MODIFIED (I.E. I NC. INCREASED IN SIZE, ENCLOSED OR SCREENED. (2 X UNIT A1END, 2 X UNIT A, 1 X UNIT A1) 1 X 3 STORY UNIT A1 END, 2 X UNIT A, 1 X UNIT A1) TOTAL U/A OF UNITS A AND A1TOTAL U/A OF UNITS A AND A1 2,852 S.F. X 3 8,556 S.F.2,852 S.F. X 3 8,556 S.F. AA-0002536 5707 SOUTH DIXIE HIGHWAY, SUITE 8 TOTAL U/A OF UNIT A1ENDTOTAL U/A OF UNIT A1END 4 STORY WEST PALM BEACH, FL. 33405 5,792 S.F.2,896 S.F. 2,896 S.F. X 2 2,896 S.F. X 1 LEGEND TEL: 561-493-1500 FAX: 561-493-1560 TOTAL U/A OF UNIT A1END 3 STORY WEBSITE: www.yra-design.com TOTAL U/A OF BUILDING14,348 S.F. 2,316 S.F. X 1 2,316 S.F.EMAIL: yra@yrainc.com MASONRY CONSTRUCTION TOTAL GARAGES (408 S.F. X 5) 2,040 S.F. BATT INSULATION (SEE FLOOR PLAN)13,768 S.F. TOTAL U/A OF BUILDING TOTAL AREA OF BUILDING16,388 S.F. SOUND BATTS (SEE FLOOR PLAN) TOTAL GARAGES (408 S.F. X 5) 2,040 S.F. COVERED ENTRIES102 S.F. CLOSED CELL FOAM INSULATION 15,808 S.F. TOTAL AREA OF BUILDING (SEE FLOOR PLAN)COVERED PATIOS 1ST FLR720 S.F. NON-BEARING FRAMED COVERED ENTRIES101 S.F. COVERED BALCONIES 2ND FLR724 S.F. CONSTRUCTION NON-BEARING FRAMED COVERED PATIOS 1ST FLR722 S.F. 285 S.F. COVERED BALCONIES 3RD FLR CONSTRUCTION WALL ABOVE OR HIDDEN COVERED BALCONIES 2ND FLR724 S.F. COVERED BALCONIES 4th FLR661 S.F. BEARING FRAME CONSTRUCTION COVERED BALCONIES 3RD FLR287 S.F. TOTAL COVERED AREA18,880 S.F. COVERED BALCONIES 4th FLR527 S.F. SOFFIT AS NOTED ON PLAN OPEN BALCONIES 4TH FLOOR1,476 S.F. 18,169 S.F. TOTAL COVERED AREA FRONT BALCONIES97 S.F. K Hovnanian Companies, LLC OPEN BALCONIES 4TH FLOOR1,178 S.F. 110 West Front Street TOTAL AREA OF BUILDING20,453 S.F. Red Bank, NJ 07701 FRONT BALCONIES97 S.F. tel: 732-383-2200 TOTAL AREA OF BUILDING19,444 S.F. date: approved: 120'-8" job no: 24'-0"24'-0"24'-0" 24'-4" 24'-4" revisions: Covered PatioCovered PatioCovered PatioCovered PatioCovered Patio OptOpt OptOptOpt PwdrPwdr PwdrPwdrPwdr BonusBonus BonusBonusBonus Family RmFamily Rm Family RmFamily RmFamily Rm Stor.Stor.Stor.Stor. MechMech MechMechMech UPUPUP UPUP site resubmital 10/7/2014 UPUPUP UPUP FoyerFoyerFoyerFoyerFoyer 2 Car Garage2 Car Garage2 Car Garage2 Car Garage 2 Car Garage SEAL 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT AUNIT A-1UNIT A-1 END sheet no. 15 ofshts Page 230 of 479 TYPICAL STAIR NOTESTYPICAL RAILING NOTESLEGEND Y RA 1. GUARDRAILS: 2. HANDRAILS: MASONRY CONSTRUCTION 3 1.RISER HEIGHT SHALL NOT EXCEED 7" PER FBC 2010 LOADING OF DISTRIBUTED LIVE LOADS AS FOLLOWS: 1 PORCHES, BALCONIES, OR RAISED FLOOR SURFACES D 4 ALL REQUIRED HANDRAILS SHALL BE ONE OF THEB) TYPE II. HANDRAILS WITH A PERIMETER GREATER THAN 6" SHALL ESIGN 4 BATT INSULATION R311.7.4.1. LOCATED MORE THAN 30" ABOVE THE FLOOR OR GRADE FOLLOWING TYPES OR PROVIDE EQUIVALENTPROVIDE A GRASPABLE FINGER RECESS AREA ON BOTH SIDES OFGUARDRAILS & HANDRAILS: 200 LBS * (SEE FLOOR PLAN) SHALL HAVE GUARDS NOT LESS THAN 42" IN HEIGHT. THE PROFILE. THE FINGER RECESS SHALL BEGIN WITHIN A DISTANCE GRASPABILITY.GUARDRAILS IN-FILL COMPONENTS:50 LBS I LANDINGS AT STAIRWAYS SHALL CONFORM TO FBC 2010** 2. NC. OPEN SIDES OF STAIRS WITH A TOTAL RISE OF MORE THAN SOUND BATTS (SEE FLOOR PLAN) 3 R311.7.5. VERTICAL RISE SHALL NOT EXCEED 12 FEET BETWEENOF " MEASURED VERTICALLY FROM THE TALLEST PORTION OF THE A) TYPE I. HANDRAILS WITH A CIRCULAR CROSS SECTION 4 30" ABOVE THE FLOOR OR GRADE BELOW SHALL HAVE FLOOR LEVELS OR LANDINGS. 57 PROFILE AND ACHIEVE A DEPTH OF AT LEAST " WITHIN " BELOW THE 1 SHALL HAVE AN OUTSIDE DIAMETER OF AT LEAST 1" AND*A SINGLE CONCENTRATED LOAD APPLIED IN ANY DIRECTION ATCLOSED CELL FOAM INSULATION 168 GUARDS NOT LESS THAN 34" IN HEIGHT MEASURED 4 WIDEST PORTION OF THE PROFILE. THIS REQUIRED DEPTH SHALL(SEE FLOOR PLAN) NOT GREATER THAN 2". IF THE HANDRAIL IS NOT CIRCULAR ANY POINT ALONG THE TOP. 3.TREAD DEPTH SHALL BE AT LEAST 10" PER FBC 2010VERTICALLY FROM THE NOSING OF THE TREADS. PORCHES 33 IT SHALL HAVE A PERIMETER DIMENSION OF AT LEAST 4" ANDCONTINUE FOR AT LEAST " TO A LEVEL THAT IS NOT LESS THAN 1" NON-BEARING FRAMED R311.7.4.2AND DECKS WHICH ARE ENCLOSED WITH INSECTGUARD IN-FILL COMPONENTS (ALL THOSE EXCEPT THE HANDRAIL) , 84** CONSTRUCTION 1 BELOW THE TALLEST PORTION OF THE PROFILE. THE MINIMUM WIDTH NOT GREATER THAN 6" WITH A MAXIMUM CROSS SECTION SCREENING SHALL BE PROVIDED WITH GUARDS WHERE THEBALUSTERS AND PANEL FILLERS SHALL BE DESIGNED TO WITHSTAND AA-0002536 4 1 NON-BEARING FRAMED 1 OF THE HANDRAIL ABOVE THE RECESS SHALL BE 1" TO A MAXIMUM WALKING SURFACE IS MORE THAN 30" ABOVE THE FLOORA HORIZONTALLY APPLIED NORMAL LOAD OF 50 POUNDS ON AN DIMENSION OF 2". 4 5707 SOUTH DIXIE HIGHWAY, SUITE 8 CONSTRUCTION WALL ABOVE 4 3 OR GRADE BELOW. SHOP DRAWINGS SHALL BE SUBMITTEDAREA EQUAL TO 1 SQUARE FOOT. THIS LOAD NEED NOT BEOR HIDDEN OF 2". EDGES SHALL HAVE A MINIMUM RADIUS OF 0.01". 4 WEST PALM BEACH, FL. 33405 BY THE BUILDER AS REQUESTED BY THE BUILDINGASSUMED TO ACT CONCURRENTLY WITH ANY OTHER LIVE LOAD TEL: 561-493-1500 FAX: 561-493-1560 DEPARTMENT. REQUIREMENT. BEARING FRAME CONSTRUCTION WEBSITE: www.yra-design.com EMAIL: yra@yrainc.com SOFFIT AS NOTED ON PLAN K Hovnanian Companies, LLC 110 West Front Street Red Bank, NJ 07701 tel: 732-383-2200 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" date: approved: job no: revisions: Covered DeckCovered DeckCovered DeckCovered DeckCovered Deck Great RoomGreat RoomGreat RoomGreat RoomGreat Room DiningDining KitchenKitchenKitchen UPUPUPUPUP DNDNDNDNDN KitchenKitchen site DiningDiningDining resubmital Pwd.Pwd.Pwd.Pwd.Pwd. 10/7/2014 SEAL 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT AUNIT A-1UNIT A-1 END sheet no. 15 ofshts Page 231 of 479 LEGEND Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION (SEE FLOOR PLAN) I NC. SOUND BATTS (SEE FLOOR PLAN) CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) NON-BEARING FRAMED CONSTRUCTION AA-0002536 NON-BEARING FRAMED 5707 SOUTH DIXIE HIGHWAY, SUITE 8 CONSTRUCTION WALL ABOVE OR HIDDEN WEST PALM BEACH, FL. 33405 TEL: 561-493-1500 FAX: 561-493-1560 BEARING FRAME CONSTRUCTION WEBSITE: www.yra-design.com EMAIL: yra@yrainc.com SOFFIT AS NOTED ON PLAN K Hovnanian Companies, LLC 110 West Front Street Red Bank, NJ 07701 tel: 732-383-2200 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" date: 7'-5"7'-5"7'-1"7'-5"7'-5"40'-11"7'-5"7'-1"7'-5"7'-5" 6'-0"3'-6"6'-0"13'-0"51'-6"3'-6"3'-6"6'-0"3'-6"6'-0" approved: job no: revisions: PatioPatioPatioPatioPatio Master Master Master Suite SuiteSuite BathBathBathBathBath Master Master Suite Suite WICWICWICWICWIC DNDNDNDNDN Hall BathHall BathHall BathHall BathHall Bath ClCl LdryLdryLdryLdryLdry ClClCl site Bedroom #3Bedroom #2Bedroom #3Bedroom #2Bedroom #2Bedroom #3Bedroom #2Bedroom #3Bedroom #2Bedroom #3 resubmital 10/7/2014 3'-3"7'-7"3'-6"3'-6"4'-4"2'-2"2'-10"3'-2"3'-8"4'-4"4'-4"3'-8"2'-0"45'-1"2'-0"2'-2"3'-8"4'-4"4'-4"3'-6"3'-6"4'-4"4'-4"3'-8"3'-3"3'-2"2'-10"2'-2"4'-4"3'-6"3'-6"4'-4"3'-3"3'-3" SEAL 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT A-1UNIT AUNIT A-1 END sheet no. 15 ofshts Page 232 of 479 120'-8" LEGEND 24'-0"24'-0"24'-0"24'-4" 24'-4" Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION (SEE FLOOR PLAN) I NC. SOUND BATTS (SEE FLOOR PLAN) CLOSED CELL FOAM INSULATION Open BalconyOpen BalconyOpen BalconyOpen Balcony (SEE FLOOR PLAN) NON-BEARING FRAMED CONSTRUCTION AA-0002536 NON-BEARING FRAMED TrellisTrellisTrellisTrellis 5707 SOUTH DIXIE HIGHWAY, SUITE 8 CONSTRUCTION WALL ABOVE OR HIDDEN WEST PALM BEACH, FL. 33405 TEL: 561-493-1500 FAX: 561-493-1560 BEARING FRAME CONSTRUCTION WEBSITE: www.yra-design.com EMAIL: yra@yrainc.com SOFFIT AS NOTED ON PLAN Covered PatioCovered PatioCovered PatioCovered Patio K Hovnanian Companies, LLC 110 West Front Street Red Bank, NJ 07701 DNDNDNDN tel: 732-383-2200 LoftLoftLoftLoft BathBathBathBath date: A/CA/CA/C approved: job no: revisions: 24'-4" 24'-0" 24'-4"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT A-1 UNIT A3 STORY, UNIT A-1 END 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" Open BalconyOpen BalconyOpen BalconyOpen BalconyOpen Balcony TrellisTrellisTrellisTrellisTrellis site resubmital Covered PatioCovered PatioCovered PatioCovered PatioCovered Patio 10/7/2014 SEAL DNDNDNDNDN LoftLoftLoftLoftLoft BathBathBathBathBath A/CA/CA/CA/CA/C sheet no. 24'-4" 24'-4"24'-0"24'-0"24'-0" 120'-8" UNIT A-1 ENDUNIT AUNIT AUNIT A-1 END UNIT A-1 15 ofshts Page 233 of 479 LEGEND UNIT A1AREA CALCS. Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION 4 STORY (SEE FLOOR PLAN) I NC. PER UNIT SOUND BATTS (SEE FLOOR PLAN) GROUND FLR U/A484 S.F. CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) SECOND FLR U/A844 S.F. NON-BEARING FRAMED CONSTRUCTION THIRD FLR U/A943 S.F. AA-0002536 NON-BEARING FRAMED FOURTH FLR U/A581 S.F. 5707 SOUTH DIXIE HIGHWAY, SUITE 8 CONSTRUCTION WALL ABOVE OR HIDDEN WEST PALM BEACH, FL. 33405 TOTAL U/A2,852 S.F. TEL: 561-493-1500 FAX: 561-493-1560 BEARING FRAME CONSTRUCTION WEBSITE: www.yra-design.com 408 S.F. 2 CAR GARAGE EMAIL: yra@yrainc.com SOFFIT AS NOTED ON PLAN OPTIONAL TOTAL AREA PER UNIT3,260 S.F. DUMB- WAITER. COVERED ENTRY20 S.F. 2'-8" COVERED PATIO 1ST FLR144 S.F. 4'-7"4'-7" COVERED BALCONY 2ND FLR144 S.F. COVERED BALCONY 3RD FLR57 S.F. COVERED BALCONY 4TH FLR131 S.F. SHOWER TOTAL COVERED AREA3,756 S.F. 2'-9" Stor. 294 S.F. OPEN BALCONY 4TH FLOOR FRONT BALCONIES19 S.F. Bath TOTAL AREA OF UNIT4,069 S.F. 9'-2" FLAT CLG. K Hovnanian Companies, LLC 110 West Front Street 11'-10"11'-6" Red Bank, NJ 07701 LAV. LAV. tel: 732-383-2200 2'-4" OPTIONAL DUMB W.C. WAITER. date: approved: job no: 24'-0" revisions: 42" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON 42" MTL RAILING W/42" HIGH ALUMINUM FENCE42" HIGH ALUMINUM FENCE SHEET A-2.1 24'-0"24'-0" VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE 6'-9"7'-5"6'-0"3'-2"7'-2"4'-6"4'-10"6'-10" 4"4"4"4"4"4"4"4" TYPICAL RAILING NOTES ON SHEET A-2.1 LINE OF BALCONY ABOVE 1'-4" 1'-4"1'-4"1'-4" 4'-7"10'-10"4'-7" 4"7'-2"9'-2"7'-0"4" 4"4" Patio Covered Patio 4"Covered Deck Master Suite Opt SHOWER 9'-2" FLAT CLG. Pwdr BATH TUB 22'-8" F.F.L. 4" 4"3'-0"6'-3" 11-4" F.F.L. 9'-4" FLAT CLG. Bath W.C. 23'-4" 19'-10"4"3'-2" 9'-2" FLAT CLG. Great 4" 13'-5"6'-0"4"3'-3" Bonus Room Family Rm Stor LAV. LAV. 9'-4" FLAT CLG. 0'-0" REF SLAB 9'-4" FLAT CLG. (SEE CIVIL DWGS) OPTIONAL CABINETS 4"6'-0" A.H.U 4" 8" W.C. 4'-3"4'-2"12'-6"2'-1" AC CHASE RAILING Mech WIC UPUPUP 9'-2" FLAT CLG. site 18R18R 18R E.W.H. Dining Room Stor. resubmital DNDN ELEC. PANEL (V.L.O.J) 9'-4" FLAT CLG. 18R18R LAV. 10/7/2014 W.C. 60 GAL. ELEC. WATER HEATER Hall Bath 4'-0" 8"19'-7" 3'-5"4"5'-0"8'-6"2'-1"3'-5"4" 9'-2" FLAT CLG. FOR OPTIONAL FOR OPTIONALWOOD OPTIONAL DUMB WAITER. Cl Ldry DUMBWAITER. SEEVENEER FACE FAMILY SEE PLAN ABOVE PLAN ABOVE CENTER LOW WALL SEAL @ 42" A.F.F. 2'-6" DW DBL SINK 3'-10" COUNTER CL. W/ DISP. TOP @ 36" A.F.F. LINE OF OVERHEAD DOOR LINE OF UP CABS. 18R ABOVE 4" 18'-0" 4" 5'-0" 2'-1"3'-10"4" Foyer Bedroom #3Bedroom #2 Kitchen 2 Car Garage 9'-2" FLAT CLG.LAV. 9'-2" FLAT CLG. 9'-4" FLAT CLG. 9'-4" FLAT CLG. 24" COUNTER TOP @ 36" 11'-10"4"11'-2"AFF 6" 5'-9"4"1'-11"4"12'-0"2'-6" W.C. LINE OF BUILDING ABOVE sheet no. 36" MTL RAILING W/ Balcony VERTICAL 8" 2'-6"2'-2"1'-8"16'-0"1'-8" BALLUSTRADES 2'-10"3'-4"4'-6"3'-4"3'-4"4'-6"2'-2" (DESIGN T.B.D.) SEE Pwdr. 24'-8" TYPICAL RAILING NOTES 24'-0" 42" MTL RAILING W/ VERTICAL 2'-10"3'-4"4'-6"3'-4"3'-4"4'-6"2'-2" ON SHEET A-2.1 BALLUSTRADES (DESIGN T.B.D.) Rm SEE TYPICAL RAILING NOTES ON 24'-0" SHEET A-2.1 15 ofshts Page 234 of 479 Y RA D ESIGN I NC. AA-0002536 5707 SOUTH DIXIE HIGHWAY, SUITE 8 WEST PALM BEACH, FL. 33405 TEL: 561-493-1500 FAX: 561-493-1560 WEBSITE: www.yra-design.com EMAIL: yra@yrainc.com 42" MTL RAILING W/ VERTICAL42" MTL RAILING W/ VERTICAL42" MTL RAILING W/ VERTICAL42" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.)BALLUSTRADES (DESIGN T.B.D.)BALLUSTRADES (DESIGN T.B.D.)BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ONSEE TYPICAL RAILING NOTES ONSEE TYPICAL RAILING NOTES ONSEE TYPICAL RAILING NOTES ON SHEET A-2.1SHEET A-2.1SHEET A-2.1SHEET A-2.1 24'-0"24'-0"24'-0"24'-0" 8"8"8"8"8"8"8"8" 23'-4"23'-4"23'-4"23'-4" K Hovnanian Companies, LLC 110 West Front Street 4'-11"4'-11"1'-4"1'-4"10'-10"10'-10"1'-4"1'-4"4'-11"4'-11"4'-11"4'-11"1'-4"1'-4"10'-10"10'-10"1'-4"1'-4"4'-11"4'-11" 4"4"4"4"4"4"4"4"4"4"4"4"4"4"4"4" Red Bank, NJ 07701 tel: 732-383-2200 Open PatioOpen PatioOpen PatioOpen Patio 8"8" date: TrellisTrellisTrellisTrellis approved: job no: revisions: Covered PatioCovered PatioCovered PatioCovered Patio 1'-4"1'-4"1'-4"1'-4" 7'-8"7'-8"15'-0"15'-0"7'-8"7'-8"15'-0"15'-0" 33'-10" F.F.L.33'-10" F.F.L. DNDN DNDN LoftLoft 18R18R LoftLoft RAILINGRAILING 9'-2" FLAT CLG.9'-2" FLAT CLG. A/CA/C LAV.LAV. W.C.W.C. 4"4"4"4" 3'-1"3'-1"6'-6"6'-6"13'-1"13'-1" BathBath 13'-6"13'-6" 2'-2"2'-2"5'-7"5'-7" 4"4" 9'-2" FLAT CLG.9'-2" FLAT CLG. 4"4" A/CA/C site resubmital BathBath 10/7/2014 8"8" 6'-1"6'-1" 4"4"14'-2"14'-2"4"4"8"8"4'-1"4'-1"4"4"18'-11"18'-11" Bedroom #4Bedroom #4 SEAL 4'-0"4'-0"2'-2"2'-2"4'-6"4'-6"3'-4"3'-4"3'-4"3'-4"4'-6"4'-6"2'-6"2'-6"3'-10"3'-10"2'-4"2'-4"3'-6"3'-6"4'-4"4'-4"4'-4"4'-4"3'-6"3'-6"2'-2"2'-2" 24'-0"24'-0"24'-0"24'-0" sheet no. 15 ofshts Page 235 of 479 LEGEND UNIT A1 END AREA CALCS. Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION 3 STORY - BUILDING 6 ONLY (SEE FLOOR PLAN) I NC. PER UNIT SOUND BATTS (SEE FLOOR PLAN) GROUND FLR U/A484 S.F. CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) SECOND FLR U/A863 S.F. NON-BEARING FRAMED CONSTRUCTION THIRD FLR U/A969 S.F. AA-0002536 NON-BEARING FRAMED 5707 SOUTH DIXIE HIGHWAY, SUITE 8 CONSTRUCTION WALL ABOVE OR HIDDEN TOTAL U/A2,316 S.F. WEST PALM BEACH, FL. 33405 2 CAR GARAGE408 S.F. TEL: 561-493-1500 FAX: 561-493-1560 BEARING FRAME CONSTRUCTION 4'-7"4'-7" WEBSITE: www.yra-design.com TOTAL AREA PER UNIT2,724 S.F. EMAIL: yra@yrainc.com SOFFIT AS NOTED ON PLAN OPTIONAL COVERED ENTRY20 S.F. DUMB- WAITER 2'-8" SHOWER COVERED PATIO 1ST FLR146 S.F. COVERED BALCONY 2ND FLR146 S.F. 2'-9" COVERED BALCONY 3RD FLR59 S.F. TOTAL COVERED AREA3,095 S.F. Bath FRONT BALCONIES20 S.F. 9'-2" FLAT CLG. TOTAL AREA OF UNIT3,115 S.F. LAV.LAV. K Hovnanian Companies, LLC 11'-10"11'-6" 110 West Front Street W.C. Red Bank, NJ 07701 tel: 732-383-2200 2'-8" OPTIONAL DUMB- WAITER date: approved: 24'-4" job no: 42" MTL RAILING W/ VERTICAL revisions: BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 42" HIGH ALUMINUM FENCE42" HIGH ALUMINUM FENCE 24'-0" 24'-4" 4"16'-3"6'-0"7'-5"7'-5"4"4"6'-10"4'-8"4'-8"7'-2"4"4" 4" LINE OF BALCONY ABOVE 16" X16"42" MTL Covered Deck 4"7'-0"9'-2"7'-2"4" 4"4" Patio CMU PIER(DESIGN T.B.D.) 4" Covered Patio MasterSuite Opt 9'-2" FLAT CLG. 11'-4" F.F.L. Pwdr 6'-3"3'-0"22'-8" F.F.L. 4" 9'-4" FLAT CLG. Bath W.C. 23'-4" 3'-2"4"19'-10" 9'-2" FLAT CLG. 4" 3'-3"4"6'-0"13'-5" Bonus Great Family Rm RoomStor LAV.LAV. 0'-0" REF SLAB 9'-4" FLAT CLG. 9'-4" FLAT CLG. (SEE CIVIL DWGS) 4" A.H.U W.C. AC CHASE RAILING Mech WIC UP UPUP 18R18R 18R E.W.H. 8"6'-4" 4"4"2'-1" 2'-0"4'-4"4"site Dining Room Stor. DNDN ELEC. PANEL (V.L.O.J) 18R resubmital 9'-4" FLAT CLG.18R LAV. W.C. 60 GAL. ELEC. WATER HEATER 10/7/2014 OPTIONAL Hall Bath FAMILY CENTER 19'-7"4" 2'-1"8'-6"4'-4"4'-8"3'-5"3'-5" 8" 9'-2" FLAT CLG. WOOD FOR OPTIONAL FOR OPTIONAL VENEER FACE 4" Ldry DUMBWAITERDUMBWAITER Cl SEE PLAN ABOVE SEE PLAN ABOVE LOW WALL @ 42" A.F.F. SEAL 2'-6" DW DBL SINK3'-10" COUNTER W/ DISP. TOP @ 36" A.F.F. Cl LINE OF OVERHEAD DOOR LINE OF UP CABINETS ABOVE 18R 4" 18'-0"5'-0" 4"4" 3'-10"2'-1" Foyer Bedroom #2Bedroom #3 Kitchen 2 Car Garage LAV. 9'-2" FLAT CLG. 9'-2" FLAT CLG. 9'-4" FLAT CLG. Pwdr 9'-4" FLAT CLG. 24" COUNTER TOP @ 36" AFF 11'-2"4"11'-10" 6" 4"5'-9" 2'-6"12'-0"4"W.C. LINE OF BUILDING ABOVE sheet no. Balcony 2'-10" 2'-2"4'-6"3'-4"3'-4"4'-6"3'-3"3'-3"4"1'-10"4'-6"3'-4"3'-4"4'-6"3'-4"2'-6"4"1'-4"16'-0"1'-8"2'-2" 42" MTL RAILING W/ VERTICAL 24'-0"24'-0" 24'-4" BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 36" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 15 ofshts Page 236 of 479 UNIT A1 END AREA CALCS. Y RA D ESIGN 4 STORY I NC. PER UNIT GROUND FLR U/A496 S.F. SECOND FLR U/A852 S.F. THIRD FLR U/A957 S.F. AA-0002536 FOURTH FLR U/A591 S.F. 5707 SOUTH DIXIE HIGHWAY, SUITE 8 WEST PALM BEACH, FL. 33405 TOTAL U/A2,896 S.F. TEL: 561-493-1500 FAX: 561-493-1560 WEBSITE: www.yra-design.com 408 S.F. 2 CAR GARAGE EMAIL: yra@yrainc.com TOTAL AREA PER UNIT3,304 S.F. COVERED ENTRY21 S.F. COVERED PATIO 1ST FLR144 S.F. COVERED BALCONY 2ND FLR146 S.F. COVERED BALCONY 3RD FLR57 S.F. COVERED BALCONY 4TH FLR134 S.F. TOTAL COVERED AREA3,806 S.F. 298 S.F. OPEN BALCONY 4TH FLOOR FRONT BALCONIES20 S.F. TOTAL AREA OF UNIT4,124 S.F. K Hovnanian Companies, LLC 110 West Front Street Red Bank, NJ 07701 tel: 732-383-2200 24'-0" 8"8" 42" MTL RAILING W/ VERTICAL 23'-4" 24'-4" BALLUSTRADES (DESIGN T.B.D.) 4'-11"1'-4"10'-10"1'-4"4'-11"4"SEE TYPICAL RAILING NOTES ON 4"4"4" 8"4'-11"1'-4"10'-10"1'-4"4'-3" SHEET A-2.1 date: approved: job no: Open Patio revisions: Open Patio 8" Trellis Trellis Covered Patio Covered Patio 8" 8" 7'-8" 8"15'-0" 1'-4" 7'-8" 15'-0" 6 10' 33'-10" F.F.L. 2 9' DNDN 18R Loft Loft 9'-2" FLAT CLG. A/C LAV. W.C. Bathsite 9'-2" FLAT CLG. 4" 13'-1"4" 6'-6" 13'-6"5'-7" 2'-2" 4" resubmital 4" 10/7/2014 A/C 8" 8"18'-11"4"4'-1" Bath SEAL 6'-1" 4"14'-2"4" Bedroom #4 2'-2"3'-6"4'-4"4'-4"3'-6"2'-4"3'-10" 24'-0" 2'-6"4'-6"3'-4"3'-4"4'-6"2'-2"4'-0" 24'-0" sheet no. 15 ofshts Page 237 of 479 LEGEND UNIT A AREA CALCS. Y RA MASONRY CONSTRUCTION D ESIGN BATT INSULATION 4 STORY (SEE FLOOR PLAN) I NC. PER UNIT SOUND BATTS (SEE FLOOR PLAN) GROUND FLR U/A484 S.F. CLOSED CELL FOAM INSULATION (SEE FLOOR PLAN) SECOND FLR U/A844 S.F. NON-BEARING FRAMED CONSTRUCTION THIRD FLR U/A943 S.F. AA-0002536 NON-BEARING FRAMED FOURTH FLR U/A581 S.F. 5707 SOUTH DIXIE HIGHWAY, SUITE 8 CONSTRUCTION WALL ABOVE OR HIDDEN WEST PALM BEACH, FL. 33405 TOTAL U/A2,852 S.F. TEL: 561-493-1500 FAX: 561-493-1560 BEARING FRAME CONSTRUCTION WEBSITE: www.yra-design.com 408 S.F. 2 CAR GARAGE EMAIL: yra@yrainc.com SOFFIT AS NOTED ON PLAN TOTAL AREA PER UNIT3,260 S.F. COVERED ENTRY20 S.F. OPTIONAL COVERED PATIO 1ST FLR144 S.F. DUMB- WAITER 2'-8" COVERED BALCONY 2ND FLR144 S.F. 4'-7"4'-7" COVERED BALCONY 3RD FLR57 S.F. COVERED BALCONY 4TH FLR131 S.F. SHOWER TOTAL COVERED AREA3,756 S.F. 294 S.F. 2'-9"OPEN BALCONY 4TH FLOOR FRONT BALCONIES19 S.F. Bath TOTAL AREA OF UNIT4,096 S.F. K Hovnanian Companies, LLC 9'-2" FLAT CLG. 110 West Front Street Red Bank, NJ 07701 tel: 732-383-2200 11'-10"11'-6" LAV. LAV. 2'-8" OPTIONAL DUMBWAITER W.C. date: approved: job no: revisions: 24'-0" 42" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE TYPICAL RAILING NOTES ON SHEET A-2.1 42" MTL RAILING W/42" HIGH ALUMINUM FENCE42" HIGH ALUMINUM FENCE 24'-0" 24'-0" VERTICAL BALLUSTRADES (DESIGN T.B.D.) SEE 3'-2"6'-0"7'-5"6'-9"8"6'-8"4'-8"4'-8"7'-0"4" 4"4"4"4"8"4" TYPICAL RAILING NOTES ON SHEET A-2.1 LINE OF BALCONY ABOVE 1'-4"4'-7"1'-4"10'-10"1'-4"4'-7"1'-4" 4"4"4"4" 7'-0"9'-2"7'-2" Patio Covered Deck Covered Patio 4" Master Suite Opt SHOWER 9'-2" FLAT CLG. Great BATH Pwdr 22'-8" F.F.L. 11'-4" F.F.L. 0'-0" REF SLAB Room 6'-3"3'-0" 4" 9'-4" FLAT CLG.(SEE CIVIL DWGS) Bath 9'-4" FLAT CLG. W.C. 23'-4" 3'-2"19'-10" 4" 9'-2" FLAT CLG. 3'-3"6'-0"4"13'-5" 4" Bonus OPTIONAL Family Rm Stor CABINETS LAV. LAV. 4" 2'-0"3'-9"3'-10"5'-1"4'-2"4'-2" 9'-4" FLAT CLG. AC CHASE 4"A.H.U W.C. Kitchen RAILING Mech 9'-4" FLAT CLG. WIC site UPUPUP 9'-2" FLAT CLG. ISLAND 18R18R E.W.H.18R 4" 4" 2'-0"6'-4"4'-4" RAILING resubmital D.W. Stor. LINE OF DNDN CABINETS 10/7/2014 ELEC. PANEL (V.L.O.J) ABOVE 18R 18R LAV. 60 GAL. ELEC. W.C. WATER HEATER FOR OPTIONAL Hall Bath DUMBWAITER SEE PLAN ABOVE WASH. 4" 19'-7"3'-5" 9'-2" FLAT CLG. LOW WALL FOR OPTIONAL @ 42" A.F.F. WIC 8"4"4" DUMBWAITER SEE 2'-1"4'-0"3'-10"7'-0"2'-5"3'-4"SEAL PLANS ABOVE DRY. 24" COUNTER M.W. TOP @ 36" OPTIONAL AFF FAMILY CENTER WOOD 3'-10" COUNTER VENEER TOP @ 36" A.F.F. FACE CL. LINE OF OVERHEAD DOOR UP 4" 18R 4'-8" 18'-4" 4" 4"3'-11" 2'-0" Dining Foyer Bedroom #2Bedroom #3 Room 2 Car Garage LAV. 9'-2" FLAT CLG. 9'-4" FLAT CLG. 9'-2" FLAT CLG. 9'-4" FLAT CLG. 6" 8" 8"16'-9"4"5'-9" 11'-6"11'-6" 4" W.C. FULL HEIGHT CABINET sheet no. Pwdr. LINE OF BUILDING ABOVE Rm 11" 8'-0"8'-0"2'-2"2'-6" 2'-2"3'-6"4'-4"4'-4"3'-6"3'-8"2'-6" 36" MTL RAILING W/ VERTICAL BALLUSTRADES (DESIGN T.B.D.)24'-0" 24'-0" 2'-2"3'-6"4'-4"4'-4"3'-6"3'-4"2'-10"SEE TYPICAL RAILING NOTES ON SHEET A-2.1 24'-0" 15 ofshts Page 238 of 479 Y RA D ESIGN I NC. AA-0002536 5707 SOUTH DIXIE HIGHWAY, SUITE 8 WEST PALM BEACH, FL. 33405 TEL: 561-493-1500 FAX: 561-493-1560 WEBSITE: www.yra-design.com EMAIL: yra@yrainc.com 24'-0" K Hovnanian Companies, LLC 110 West Front Street 8"8" 42" MTL RAILING W/ VERTICAL 23'-4"Red Bank, NJ 07701 24'-4" BALLUSTRADES (DESIGN T.B.D.) tel: 732-383-2200 4'-11"1'-4"10'-10"1'-4"4'-11"SEE TYPICAL RAILING NOTES ON 4"4"4"4" 8" 4'-11"1'-4"10'-10"1'-4"4'-3" SHEET A-2.1 Open Patio Open Patio date: 8" approved: Trellis Trellis job no: revisions: Covered Patio Covered Patio 8" 8" 8"15'-0"7'-8" 1'-4" 15'-0"7'-8" 6 10' 33'-10" F.F.L. 2 9' DN DN 18R Loft Loft 9'-2" FLAT CLG. A/C LAV. W.C. Bath 9'-2" FLAT CLG. 4" 13'-1"4" 6'-6" 13'-6" 5'-7"2'-2" 4" 4" site A/C resubmital 8" 18'-11"4"4'-1" 8" 10/7/2014 Bath 6'-1" 4"14'-2"4" Bedroom #4 SEAL 2'-2"3'-6"4'-4"4'-4"3'-6"2'-4"3'-10" 24'-0" 2'-6"4'-6"3'-4"3'-4"4'-6"4'-0" 2'-2" 24'-0" sheet no. 15 ofshts Page 239 of 479 Page 240 of 479 Page 241 of 479 Page 242 of 479 Y RA D ESIGN 8 I NC. 12 4TYP. + 42'-10"+ 42'-10" AA-0002536 T.O.B. T.O.B.24 5707 SOUTH DIXIE HIGHWAY, SUITE 8 + 41'-6" + 41'-6" T.O.B. T.O.B.WEST PALM BEACH, FL. 33405 5 19 TEL: 561-493-1500 FAX: 561-493-1560 WEBSITE: www.yra-design.com 4 EMAIL: yra@yrainc.com 669 23 15 + 32'-6"+ 32'-6" 4TH FLR LEVEL4TH FLR LEVEL 15 9 2 16 9 12 6 K Hovnanian Companies, LLC 110 West Front Street Red Bank, NJ 07701 + 21'-6"+ 21'-6" tel: 732-383-2200 3RD FLR LVL 3RD FLR LVL 17 2 2 6 12 16 date: approved: job no: 20 revisions: + 10'-0"+ 10'-0" 2nd FLR LVL. 2nd FLR LVL. 7 2 2 29 ELEC. METER VLOJ (V.L.O.J.)(V.L.O.J.)(V.L.O.J.) COMP.COMP.COMP. A/CA/CA/C + 0'-0" + 0'-0" T.O. SLAB. T.O. SLAB. 12 TYP. 4 + 42'-10"+ 42'-10" T.O.B.T.O.B. + 41'-6" + 41'-6" T.O.B. T.O.B. site + 32'-6"+ 32'-6" KEYED ELEVATION NOTES 4TH FLR LEVEL4TH FLR LEVEL resubmital 1 DECORATIVE WOOD BRACKET (SEE 4/A-4.2) CEMENT PAVERS (TREMRON; HERITAGE COLOR, HERRINGBONE 90 PATTERN) 13 10/7/2014 2 STUCCO FINISH (OLD WORLD KNOCKDOWN) WITH SHERWIN WILLIAMS MONTEREY WHITE DECORATIVE WOOD BRACKET (SEE 5/A-4.2) 14 3CLOPAY EXTERIOR DOORS AND GARAGE DOORS W/ WALNUT FINISH COLOR 15 PIER 1 (SEE 2/A-4.1) 4 DECORATIVE SHUTTERS & AWNINGS PAINTED SHERWIN WILLIAMS BLACK MAGIC COLOR 16PIER 1 (SEE 3/A-4.1) 5 FLAT STUCCO PAINTED SHERWIN WILLIAMS POLISHED MAHOGANY COLOR 17 CAST STONE COLUMN ON PIER 1 (SEE 1/A-4.2)+ 21'-6"+ 21'-6" 3RD FLR LVL SEAL 3RD FLR LVL 6RAILINGS PAINTED SHERWIN WILLIAMS BLACK MAGIC COLOR 18 DECORATIVE WOOD BRACKET (SEE 8/A-4.2) 7 OWENS CORNING STONE CULTURED STONE (CORAL STONE STYLE AND FOSSIL REEF COLOR) 19OUTRIGGER (SEE 6/A-4.2) EAGLE ROOFING ROOF TILE (PONDEROSA STYLE AND SIERRA MADRE COLOR) 8 20DECORATIVE WOOD BRACKET (SEE 9/A-4.2) WINDOWS AND SLIDING GLASS DOORS (BRONZE FRAME) 9 21DECORATIVE WOOD BRACKET (SEE 9/A-4.2) 9 10CAST STONE SILL 22CAST STONE PILASTERS FAUX WOOD HEADER 11 23CAST STONE SILL + 10'-0"+ 10'-0" 12CAST STONE 24WOODEN TRELLIS 2nd FLR LVL. 2nd FLR LVL. NOTE 1. BACK-FLOW PREVENTERS SHALL BE PAINTED TO MATCH sheet no. THE PRINCIPAL STRUCTURE AND SCREENED FROM VIEW. + 0'-0" + 0'-0" 2. EQUIPMENT PLACED ON WALLS OF BUILINGS SHALL BE T.O. SLAB.T.O. SLAB. PAINTED TO MATCH THE BUILDING COLOR. 15 ofshts Page 243 of 479 120'-8" 24'-0"24'-0" 24'-0"24'-4" 24'-4" Y RA D ESIGN I NC. AA-0002536 5707 SOUTH DIXIE HIGHWAY, SUITE 8 WEST PALM BEACH, FL. 33405 TEL: 561-493-1500 FAX: 561-493-1560 WEBSITE: www.yra-design.com EMAIL: yra@yrainc.com TOP OF CONCRETE BEAM BEARING LEGEND ELEV.SYMBOL + 41'-6" 1 1 + 42'-10" A-6 A-6 K Hovnanian Companies, LLC 110 West Front Street Red Bank, NJ 07701 DNDNDNDN tel: 732-383-2200 RAKED RIDGE RIDGE FIRE RATED SOFFIT date: + 31'-2" BLDNG. 6 ONLY approved: job no: revisions: + 32'-6" BLDNG. 6 ONLY 24'-4" 24'-0" 24'-4"24'-0"24'-0" 4'-0"4'-0" AREA RESERVED FOR FIRE 120'-8" RETARDANT TREATED WOOD NOTE: NO ROOF PENETRATIONS TO BE SEE (6/A-7.1) TYPICAL FIRE SHEATHING. BUILDING CODE WITHIN 4'-0" OF TENANT SEPARATION. RATED SOFFIT DETAIL SECTION 706.4.1.2 120'-8" 24'-0"24'-0"24'-0"24'-4" 24'-4" site resubmital 10/7/2014 1 1 A-6 A-6 SEAL DNDNDNDNDN RIDGE sheet no. 24'-4" 24'-4"24'-0"24'-0"24'-0" 4'-0"4'-0" AREA RESERVED FOR FIRE 120'-8" RETARDANT TREATED WOOD NOTE: NO ROOF PENETRATIONS TO BE SEE (6/A-7.1) TYPICAL FIRE SHEATHING. BUILDING CODE WITHIN 4'-0" OF TENANT SEPARATION. RATED SOFFIT DETAIL SECTION 706.4.1.2 15 ofshts Page 244 of 479 Page 245 of 479 Page 246 of 479 Page 247 of 479 Page 248 of 479 Page 249 of 479 Page 250 of 479 Page 251 of 479 Page 252 of 479 Page 253 of 479 Page 254 of 479 Page 255 of 479 Page 256 of 479 Page 257 of 479 Page 258 of 479 Page 259 of 479 Page 260 of 479 Page 261 of 479 Page 262 of 479 Page 263 of 479 Page 264 of 479 Page 265 of 479 Page 266 of 479 Page 267 of 479 Page 268 of 479 Page 269 of 479 Page 270 of 479 Page 271 of 479 Page 272 of 479 Page 273 of 479 Page 274 of 479 Page 275 of 479 Page 276 of 479 Page 277 of 479 Page 278 of 479 Page 279 of 479 Page 280 of 479 Page 281 of 479 Page 282 of 479 Page 283 of 479 Page 284 of 479 Page 285 of 479 Page 286 of 479 Page 287 of 479 Page 288 of 479 Page 289 of 479 Page 290 of 479 Page 291 of 479 Page 292 of 479 Page 293 of 479 Page 294 of 479 Page 295 of 479 Page 296 of 479 Page 297 of 479 Page 298 of 479 Page 299 of 479 Page 300 of 479 Page 301 of 479 Page 302 of 479 Page 303 of 479 Page 304 of 479 Page 305 of 479 Page 306 of 479 Page 307 of 479 Page 308 of 479 Page 309 of 479 Page 310 of 479 Page 311 of 479 Page 312 of 479 Page 313 of 479 Page 314 of 479 Page 315 of 479 Page 316 of 479 Page 317 of 479 Page 318 of 479 Page 319 of 479 Page 320 of 479 Page 321 of 479 Page 322 of 479 Page 323 of 479 Page 324 of 479 Page 325 of 479 Page 326 of 479 Page 327 of 479 Page 328 of 479 Page 329 of 479 Page 330 of 479 Page 331 of 479 Page 332 of 479 Page 333 of 479 Page 334 of 479 Page 335 of 479 Page 336 of 479 Page 337 of 479 Page 338 of 479 Page 339 of 479 Page 340 of 479 Page 341 of 479 Page 342 of 479 Page 343 of 479 Page 344 of 479 Page 345 of 479 Page 346 of 479 Page 347 of 479 Page 348 of 479 Page 349 of 479 Page 350 of 479 Page 351 of 479 Page 352 of 479 Page 353 of 479 Page 354 of 479 Page 355 of 479 Page 356 of 479 Page 357 of 479 Page 358 of 479 Page 359 of 479 Page 360 of 479 Page 361 of 479 Page 362 of 479 Page 363 of 479 Page 364 of 479 Page 365 of 479 Page 366 of 479 Page 367 of 479 Page 368 of 479 Page 369 of 479 Page 370 of 479 Page 371 of 479 Page 372 of 479 Page 373 of 479 Page 374 of 479 Page 375 of 479 Page 376 of 479 Page 377 of 479 Page 378 of 479 Page 379 of 479 Page 380 of 479 Page 381 of 479 Page 382 of 479 Page 383 of 479 Page 384 of 479 Page 385 of 479 Page 386 of 479 Page 387 of 479 Page 388 of 479 Page 389 of 479 Page 390 of 479 Page 391 of 479 Page 392 of 479 Page 393 of 479 Page 394 of 479 Page 395 of 479 Page 396 of 479 Page 397 of 479 Page 398 of 479 Page 399 of 479 Page 400 of 479 Page 401 of 479 Page 402 of 479 Page 403 of 479 Page 404 of 479 Page 405 of 479 EXHIBIT 2-A DOWNTOWN TRANSIT-ORIENTED DEVELOPMENT DISTRICT FUTURE LAND USES NE 8TH AVE NE 4TH AVE SE 2ND AVE EDITH AVE 5 01252505007501,000 Feet Legend Land Use SPECIAL HIGH DENSITY RESIDENTIAL (SHDR)AGRICULTURE (A)MIXED USE SUBURBAN (MXS) LOW DENSITY RESIDENTIAL (LDR) Max. 5.00 D.U./Acre OFFICE COMMERCIAL (OC)RECREATIONAL (R)DEVELOPMENT OF REGIONAL IMPACT (DRI) MODERATE DENSITY RESIDENTIAL (MODR) Max. 7.5 D.U./Acre LOCAL RETAIL COMMERCIAL (LRC)PUBLIC & PRIVATE GOVERNMENTAL/INSTITUTIONAL (PPGI)CONSERVATION (CON) MEDIUM DENSITY RESIDENTIAL (MEDR) Max. 10.00 D.U./Acre GENERAL COMMERCIAL (GC)MIXED USE (MX)CONSERVATION OVERLAY (C/O) HIGH DENSITY RESIDENTIAL (HDR) Max. 11.00 D.U./Acre INDUSTRIAL (I)MIXED USE CORE (MXC) Page 406 of 479 Page 407 of 479 Page 408 of 479 Page 409 of 479 Page 410 of 479 Page 411 of 479 Page 412 of 479 Page 413 of 479 Page 414 of 479 Page 415 of 479 Page 416 of 479 Page 417 of 479 Page 418 of 479 Page 419 of 479 Page 420 of 479 Page 421 of 479 Page 422 of 479 Page 423 of 479 Page 424 of 479 Page 425 of 479 Page 426 of 479 Page 427 of 479 Page 428 of 479 Page 429 of 479 Page 430 of 479 Page 431 of 479 Page 432 of 479 .ERYEV] .ERYEV] 36(-2%2') %236(-2%2')3*8,)'-8=3*&3=2832&)%',*036-(% %1)2(-2+%68-'0)---3*',%48)63*8,)&3=2832&)%', '3()3*36(-2%2')7)28-80)(w)1403=))7v4)27-3240%2x %1)2(-2+7)'8-328,)()*-2-8-323*%229%0)%62-2+7 83'0%6-*=8,))<'097-3273*)0)1)2873*4%=4)6*036-(% 78%898)7 %1)2(-2+7)'8-326))1403=1)28 83%003;*368,)496',%7)3*46-36'-8=7)6:-')32%*900 %'89%6-%0&%7-7%*8)632)=)%63*6))1403=1)28&=8,) '-8=463:-(-2+*36'3(-*-'%8-32463:-(-2+*36'32*0-'8 463:-(-2+*367):)6%&-0-8=%2(463:-(-2+*36%2)**)'8-:) (%8),)6)3* ;,)6)%7XLI&SEVHSJ8VYWXIIW w8VYWXIIWx SJXLI)QTPS]IIW4IRWMSR4PERSJ XLI'MX]SJ&S]RXSR&IEGL*PSVMHE w4IRWMSR4PERx VIGSQQIRHWEQIRHQIRXSJXLI 3VHMRERGIXSGPEVMJ]XLITPERTVSZMWMSRMQTPIQIRXMRK*PSVMHE7XEXYXIW ;,)6)%7XLI8VYWXIIWSJXLI4PERVIGSQQIRHIHTIVQMXXMRKQIQFIVWXS TYVGLEWIWIVZMGIEXXLIJYPPEGXYEVMEPGSWXMJXLIQIQFIVVIUYIWXWXSTYVGLEWIWYGLXMQI QSVIXLERSRI]IEVEJXIVVIIQTPS]QIRXERH ;,)6)%7XLI'MX]'SQQMWWMSRSJXLI'MX]SJ&S]RXSR&IEGL*PSVMHEHIWMVIWXS WSEQIRHXLI)QTPS]IIW4IRWMSR4PERSJXLI'MX]SJ&S]RXSR&IEGL*PSVMHE 23;8,)6)*36)&)-836(%-2)(&=8,)'-8='311-77-323*8,) '-8=3*&3=2832&)%',*036-(% 7IGXMSR8LIJSVIKSMRKw;,)6)%7xGPEYWIWEVILIVIF]GIVXMJMIHEWFIMRKXVYI ERHGSVVIGXERHEVIMRGSVTSVEXIHLIVIMRF]XLMWVIJIVIRGI 7IGXMSR8LIHIJMRMXMSRSJ%RRYEP)EVRMRKWSJ7IGXMSRSJ%VXMGPI--SJ 4EKISJ Page 433 of 479 'LETXIVSJXLI&S]RXSR&IEGL'SHISJ3VHMRERGIWMWLIVIF]EQIRHIHEWJSPPS[W 7IG(IJMRMXMSRW 8LIJSPPS[MRK[SVHWERHTLVEWIWEWYWIHMRXLMWEVXMGPIYRPIWWEHMJJIVIRXQIERMRK MWTPEMRP]VIUYMVIHF]XLIGSRXI\XWLEPPLEZIXLIJSPPS[MRKQIERMRKWERHXLIWEQIERH WMQMPEVXIVQW[LIRYWIHMRGSRRIGXMSR[MXLER]GMZMPWIVZMGIW]WXIQSVER]SXLIVSVHMRERGI SJXLIGMX]WLEPPRSXRIGIWWEVMP]ETTP]XSXLIQIQFIVWSJXLIVIXMVIQIRXW]WXIQLIVIF] GVIEXIHI\GITX[LIRWTIGMJMGEPP]EHSTXIH %RRYEPIEVRMRKW+VSWWIEVRMRKWVIGIMZIHF]XLIIQTPS]IIEWGSQTIRWEXMSRJSV WIVZMGIWXSXLIGMX]MRGPYHMRKSZIVXMQITE]&SRYWIWWLEPPFII\GPYHIH*PI\MFPIFIRIJMXW WLEPPFII\GPYHIH)JJIGXMZI.YRISZIVXMQIMRGPYHIHMRTIRWMSREFPIGSQTIRWEXMSR MWPMQMXIHXSLSYVWTIV1IQFIVTIV]IEV4VMSVXS.YRIEPPSZIVXMQIMW MRGPYHIHMRXLIHIJMRMXMSRSJTIRWMSREFPIGSQTIRWEXMSRIJJIGXMZI.YRIRS2S LSYVWSJYRYWIHEGGYQYPEXIHWMGOERHZEGEXMSRPIEZIIEVRIHEJXIV.YRIWLEPP FIGSRWMHIVIH%RRYEP)EVRMRKW,S[IZIVTVMSVXS.YRIQIQFIVWQE]MRGPYHI EPPYRYWIHLSYVWIEVRIHTVMSVXS.YRITVSZMHIHXLEXXLIEQSYRXSJLSYVWMW[IVI GEWLIHMREXVIXMVIQIRX&IKMRRMRK[MXLERRYEPIEVRMRKWEJXIV(IGIQFIVERH TYVWYERXXS-RXIVREP6IZIRYI'SHI7IGXMSR Y XLIHIJMRMXMSRSJERRYEPIEVRMRKW MRGPYHIWEQSYRXWTEMHF]XLIGMX]EWHMJJIVIRXMEP[EKIWXSQIQFIVW[LSEVIEFWIRXJVSQ 4EKISJ Page 434 of 479 IQTPS]QIRX[LMPIMRUYEPMJMIHQMPMXEV]WIVZMGI 7IGXMSR7IGXMSRSJ%VXMGPI--SJ'LETXIVSJXLI&S]RXSR&IEGL'SHISJ 3VHMRERGIWMWLIVIF]EQIRHIHEWJSPPS[W 7IG6IIQTPS]QIRX ;LIRER]JSVQIVIQTPS]IISJXLIGMX]MWVIIQTPS]IHLISVWLI[MPPFIGSQI EQIQFIVSJXLITPERYTSRVIIQTPS]QIRXEWEJYPPXMQITIVQERIRXKIRIVEPGMX] IQTPS]II;LIREJSVQIVIQTPS]IISJXLIGMX]MWVIIQTPS]IHERHWEMHIQTPS]II LEH[MXLHVE[RGSRXVMFYXMSRWTVIZMSYWP]QEHIXSXLITPERLISVWLIQE]LEZI JSVJIMXIHGVIHMXIHWIVZMGIVIMRWXEXIHYTSRWEXMWJEGXMSRSJIEGLSJXLIJSPPS[MRK GSRHMXMSRW 8LIFVIEOMRGMX]IQTPS]QIRXMWRSXQSVIXLERQSRXLWERH 8LITPERMWTEMHXLIXSXEPEQSYRXTVIZMSYWP][MXLHVE[R GSRWMWXMRKSJ EGGYQYPEXIHQIQFIVGSRXVMFYXMSRWTPYWER]MRXIVIWXTVIZMSYWP]TEMH F]XLITPERSRXLSWIGSRXVMFYXMSRW 8LMWXSXEPEQSYRXMWFVSYKLX JSV[EVH[MXLMRXIVIWXJSVXLIXSXEPRYQFIVSJQSRXLWJVSQXLIHEXISJ [MXLHVE[EPXSXLIHEXISJVITE]QIRXGEPGYPEXIHXSXLIRIEVIWXQSRXL 8LMWGEPGYPEXIHEQSYRXIUYEPWXLIEQSYRXXSFIVITEMHXSXLITPERMR EPYQTWYQ8LIMRXIVIWXXSFVMRKJSV[EVHXLIXSXEPEQSYRX[MPPFIEX XLIIUYMZEPIRXGSQTSYRHQSRXLP]VEXIHIVMZIHJVSQXLIIEVRMRKVEXI EWWYQIHF]XLIEGXYEV]MRXLIQSWXVIGIRXEGXYEVMEPZEPYEXMSR WYFQMXXIHXSXLI(MZMWMSRSJ6IXMVIQIRXTYVWYERXXS*PSVMHE7XEXYXI 'LETXIVTEVX:-- 6ITE]QIRXSJ[MXLHVE[RGSRXVMFYXMSRWMRXIVIWXXLIVISRERH 4EKISJ Page 435 of 479 EHQMRMWXVEXMZITVSGIWWMRKJIIQYWXFIQEHIRSPEXIVXLERSRI]IEV JVSQXLIHEXIXLIJYRHvWEGXYEV]HIPMZIVWEVITE]QIRXGEPGYPEXMSRXS XLIIQTPS]II 8LIETTPMGEXMSRMWQEHI[MXLMRSRI]IEVSJVIIQTPS]QIRXF]XLIGMX] 7LSYPHEQIQFIVJEMPXSQEOIETTPMGEXMSR[MXLMRSRI]IEVSJ VIIQTPS]QIRXJSVXLITYVGLEWISJTVMSVGMX]XMQIXLIRXLI QIQFIVQE][MXLMRJMZI]IEVWSJVIIQTPS]QIRXF]XLIGMX] VIUYIWXXLITYVGLEWISJXLITVMSVGMX]XMQI8LMWXMQIQE]FI TYVGLEWIHEXXLIJYPPEGXYEVMEPMQTEGXSJXLITYVGLEWISJWIVZMGI TPYWXLIGSWXSJXLIEGXYEVMEPWIVZMGIWXSGEPGYPEXIXLIFY]FEGO ;LIREJSVQIVIQTPS]IISJXLIGMX]MWVIIQTPS]IHERHWEMHIQTPS]IILEH TVIZMSYWP]XIVQMREXIHLMWSVLIVIQTPS]QIRX[MXLEZIWXIHVMKLXXSEHIJIVVIH ERRYMX]TVSZMHIHLISVWLILEHRSX[MXLHVE[RGSRXVMFYXMSRWTVIZMSYWP]QEHIXSXLI TPERLISVWLI[MPPEKEMRFIGSQIEQIQFIVSJXLITPEREWSJXLIHEXISJLMWSVLIV VIIQTPS]QIRXEWEJYPPXMQITIVQERIRXKIRIVEPGMX]IQTPS]II8LIGVIHMXIHWIVZMGI [LMGLWYGLVIIQTPS]IHQIQFIVLEHEGGYQYPEXIHEWSJXLIHEXISJLMWSVLIVTVMSV XIVQMREXMSRSJIQTPS]QIRXWLEPPFIVIMRWXEXIHERHLISVWLIWLEPPEGGVYIEHHMXMSREP GVIHMXIHWIVZMGIJVSQXLIHEXISJLMWSVLIVVIIQTPS]QIRX%R]FIRIJMXWXS[LMGL WYGLVIIQTPS]IHQIQFIVWYFWIUYIRXP]FIGSQIWIRXMXPIHWLEPPFIFEWIHSRXLI WYQSJLMWSVLIVGVIHMXIHWIVZMGITVMSVXSLMWSVLIVTVIZMSYWXIVQMREXMSRSJ IQTPS]QIRXTPYWGVIHMXIHWIVZMGIWYFWIUYIRXP]XSLMWSVLIVVIIQTPS]QIRX 4EKISJ Page 436 of 479 7IGXMSR-XMWXLIMRXIRXMSRSJXLI'MX]'SQQMWWMSRSJXLI'MX]SJ&S]RXSR&IEGL XLEXXLITVSZMWMSRWSJXLMW3VHMRERGIWLEPPFIGSQIERHFIQEHIETEVXSJXLI'SHISJ 3VHMRERGIWSJXLI'MX]SJ&S]RXSR&IEGL*PSVMHE8LI7IGXMSRWSJXLMWSVHMRERGIQE]FI VIRYQFIVIHVIPIXXIVIHERHXLI[SVHw3VHMRERGIxQE]FIGLERKIHXSw7IGXMSRxw%VXMGPIx SVWYGLSXLIV[SVHSVTLVEWIMRSVHIVXSEGGSQTPMWLWYGLMRXIRXMSR 7IGXMSR%PP3VHMRERGIWSVTEVXWSJ3VHMRERGIW6IWSPYXMSRWSVTEVXWSJ 6IWSPYXMSRWMRGSRJPMGXLIVI[MXLFIERHXLIWEQIEVILIVIF]VITIEPIHXSXLII\XIRXSJWYGL GSRJPMGX 7IGXMSR-JER]GPEYWIWIGXMSRSVSXLIVTEVXSVETTPMGEXMSRSJXLMW3VHMRERGIWLEPP FILIPHF]ER]GSYVXSJGSQTIXIRXNYVMWHMGXMSRXSFIYRGSRWXMXYXMSREPSVMRZEPMHWYGL YRGSRWXMXYXMSREPSVMRZEPMHTEVXSVETTPMGEXMSRWLEPPFIGSRWMHIVIHEWIPMQMREXIHERHWSRSX IJJIGXMRKXLIZEPMHMX]SJXLIVIQEMRMRKTSVXMSRWSVETTPMGEXMSRWVIQEMRMRKMRJYPPJSVGIERH IJJIGX 7IGXMSR8LMW3VHMRERGIWLEPPFIGSQIIJJIGXMZIYTSRTEWWEKIYRPIWWSXLIV[MWI TVSZMHIHJSVMRXLMWEQIRHQIRX *-6786)%(-2+8,-7(%=3* 7)'32(*-2%06)%(-2+ERH4%77%+)8,-7(%=3* 4%77)(%2(%(348)(8,-7(%=3* '-8=3*&3=2832&)%',*036-(% 1E]SV :MGI1E]SV 4EKISJ Page 437 of 479 'SQQMWWMSRIV 'SQQMWWMSRIV 'SQQMWWMSRIV %88)78 '-8='0)6/ ,@&&+)@4PER(SGW@%1)2(@@%RRYEPIEVRMRKWGPEVMJMGEXMSRERHFY]FEGOSJGMX]XMQI [TH 4EKISJ Page 438 of 479 Page 439 of 479 Page 440 of 479 Page 441 of 479 Page 442 of 479 Page 443 of 479 Page 444 of 479 Page 445 of 479 Page 446 of 479 Page 447 of 479 Page 448 of 479 Page 449 of 479 Page 450 of 479 Page 451 of 479 Page 452 of 479 Page 453 of 479 Page 454 of 479 Page 455 of 479 Page 456 of 479 Page 457 of 479 Page 458 of 479 Page 459 of 479 Page 460 of 479 Page 461 of 479 Page 462 of 479 Page 463 of 479 Page 464 of 479 Page 465 of 479 Page 466 of 479 Page 467 of 479 Page 468 of 479 Page 469 of 479 Page 470 of 479 Page 471 of 479 Page 472 of 479 Page 473 of 479 Page 474 of 479 Page 475 of 479 Page 476 of 479 Page 477 of 479 '-8=3*&3=2832&)%', 'MX]%XXSVRI]vW3JJMGI 1)136%2(91 83,SRSVEFPI1E]SVERH'MX]'SQQMWWMSR 0SVM0E:IVVMIVI'MX]1EREKIV *631.EQIW%'LIVSJ'MX]%XXSVRI] 7LERE&VMHKIQER%WWMWXERX'MX]%XXSVRI] (%8)*IFVYEV] 6)6IUYIWXJSV4VMZEXI%XXSVRI]'PMIRX7IWWMSR CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 4YVWYERXXS7IGXMSR *PSVMHE7XEXYXIW-EQVIUYIWXMRKETVMZEXIEXXSVRI]GPMIRX WIWWMSRSJXLI'MX]'SQQMWWMSRXSHMWGYWWTIRHMRKPMXMKEXMSRMRXLIJSPPS[MRKGEWI '14PEMRXMJJZW'-8=3*&3=2832&)%',ERH78)4,)2 .%1)71%-36-23(IJIRHERXWz'EWI2S'% (MZMWMSR%2 -[MPPFIMREXXIRHERGIEPSRK[MXL%WWMWXERX'MX]%XXSVRI]7LERE&VMHKIQERE 'SYVX6ITSVXIVXLI1E]SVERH'MX]'SQQMWWMSR;I[MPPRIIHETTVS\MQEXIP] QMRYXIW8LIXMQIERHHEXISJXLITVMZEXIEXXSVRI]GPMIRXWIWWMSR[MPPFIWIXEXXLI1EVGL 'MX]'SQQMWWMSRQIIXMRK .%'PQW '@9WIVW@(SVXM^@%TTHEXE@0SGEP@1MGVSWSJX@;MRHS[W@8IQTSVEV]-RXIVRIX *MPIW@'SRXIRX-)@;<.<1+@6IUYIWXC*SVC)\C7IWWMSRCC 1EMSVMRS (SG Page 478 of 479 Page 479 of 479